KEGG   Physcomitrella patens subsp. patens: 112278076Help
Entry
112278076         CDS       T01041                                 

Definition
(RefSeq) succinate-semialdehyde dehydrogenase, mitochondrial-like isoform X1
  KO
K17761  succinate-semialdehyde dehydrogenase, mitochondrial [EC:1.2.1.24]
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
ppp00250  Alanine, aspartate and glutamate metabolism
ppp00650  Butanoate metabolism
ppp01100  Metabolic pathways
Module
ppp_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:ppp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    112278076
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    112278076
Enzymes [BR:ppp01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.24  succinate-semialdehyde dehydrogenase (NAD+)
     112278076
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 112278076
NCBI-ProteinID: XP_024366883
Position
26
AA seq 512 aa AA seqDB search
MRGLVGIRAKSPWLLPVLRQMGTMVQLNEAGLFKSQGLIGDKWVDAENGHTLPVNNPATG
EILTSVPFMGKREAEKAIAAASQAFTSWSKRTANDRSKILRQWFNLLIKNKDDLGKLIVL
EQGKPLAEAVGEIVYGAAFVEYYAEEAKRVYGDIIPSPFPEKRMLVMKQPVGVVAAIAPW
NFPLAMITRKVAPALAAGCTVVIKPSELTPLTALAAAELALQAGIPPGVVNVVMGDAKGI
GDAMLDSTEVRKITFTGSTGVGKMLLAGAGKTVKKVSLELGGNAPCIVFDDANLDVAVKG
VLAGKYRNSGQTCVCINKIFVQDGIYDKFAEAFAKAVSGLRAGNGLEPGITQGPLINETA
LEKVERHVQDAVSKGAKVLVGGKRHSLGRTFYEPTILGNASDEMLIFREEVFGPVAPLVR
FNTDEEAIKLANNSEFGLAAYAFTENITRGWRVAESLEFGMVGLNEGLISTEVAPFGGMK
QSGLGREGSKYGLDEYLEMKYVCLGNMAQPVG
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgagaggtttggttggaattcgagctaaatcgccatggctgctgccggtccttcgtcag
atgggcacaatggtgcagctgaacgaagcgggattgttcaaatcgcaggggcttattggt
gacaagtgggtcgatgctgaaaacggccacactctcccagttaacaatcctgccacggga
gagatcctcacgtctgtgccatttatgggtaagcgagaagcagagaaggcgatcgctgca
gcatctcaggcttttacatcttggagtaagcgaacggctaatgacaggagcaaaattcta
cgacagtggtttaacttactcataaagaataaagatgaccttgggaagctcattgtcttg
gaacaaggaaagccactcgctgaagcagtcggagagatcgtatatggtgcagcctttgta
gagtattatgcggaagaggcaaaacgagtttacggtgacataattccctctcctttccca
gagaaacgaatgctcgtgatgaaacaaccagttggagtagtagctgccatagcaccttgg
aattttcctctggccatgattactcgcaaggtagctccagcgttagcagcagggtgcact
gtcgttataaagccttcagagcttactcctttgacggcgttagctgctgcagaacttgcc
ctgcaagcaggcattcctcctggtgttgtgaacgttgtgatgggagatgcaaagggaatt
ggggatgcgatgctagacagcacagaggttcgtaaaattactttcactggctcaacagga
gttggtaaaatgctcttggctggggcgggaaagactgttaaaaaggtttccttagagctt
ggtggtaacgcaccgtgcatcgtttttgatgatgctaatttggacgttgctgttaaagga
gtgttggccggcaagtacaggaactctggccaaacttgtgtttgcatcaacaaaattttt
gtgcaagatggcatctacgacaagtttgcggaggcttttgcaaaagcagtgtcaggatta
cgcgcagggaatggcctagaaccaggcataactcagggaccattgattaatgagacagca
ctcgaaaaggttgagaggcacgtacaagacgcagtgtccaagggagcgaaagtgcttgta
ggtggcaaacggcatagtttaggtcgcacattctatgaaccaactattctcggcaacgct
agtgacgaaatgcttatcttcagggaggaagtatttgggccagttgcaccccttgtgcga
tttaacacagatgaggaagcaatcaagttggccaataattcagaatttggcctggctgca
tacgcttttactgagaatattactcgaggttggcgtgtagccgagtcacttgagtttggc
atggttggcctaaatgaaggcctcatttcaactgaggtggcacctttcggaggtatgaag
caatctggactgggtcgtgaaggctccaagtatggtcttgacgaataccttgagatgaag
tacgtgtgtcttggcaacatggcacaacccgtcggttga

DBGET integrated database retrieval system