KEGG   Physcomitrella patens subsp. patens: 112278756Help
Entry
112278756         CDS       T01041                                 

Definition
(RefSeq) aldehyde dehydrogenase family 7 member B4-like
  KO
K14085  aldehyde dehydrogenase family 7 member A1 [EC:1.2.1.31 1.2.1.8 1.2.1.3]
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
ppp00010  Glycolysis / Gluconeogenesis
ppp00053  Ascorbate and aldarate metabolism
ppp00071  Fatty acid degradation
ppp00260  Glycine, serine and threonine metabolism
ppp00280  Valine, leucine and isoleucine degradation
ppp00310  Lysine degradation
ppp00330  Arginine and proline metabolism
ppp00340  Histidine metabolism
ppp00380  Tryptophan metabolism
ppp00410  beta-Alanine metabolism
ppp00561  Glycerolipid metabolism
ppp00620  Pyruvate metabolism
ppp01100  Metabolic pathways
ppp01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ppp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    112278756
   00053 Ascorbate and aldarate metabolism
    112278756
   00620 Pyruvate metabolism
    112278756
  09103 Lipid metabolism
   00071 Fatty acid degradation
    112278756
   00561 Glycerolipid metabolism
    112278756
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    112278756
   00280 Valine, leucine and isoleucine degradation
    112278756
   00310 Lysine degradation
    112278756
   00330 Arginine and proline metabolism
    112278756
   00340 Histidine metabolism
    112278756
   00380 Tryptophan metabolism
    112278756
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    112278756
Enzymes [BR:ppp01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     112278756
    1.2.1.8  betaine-aldehyde dehydrogenase
     112278756
    1.2.1.31  L-aminoadipate-semialdehyde dehydrogenase
     112278756
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 112278756
NCBI-ProteinID: XP_024368243
Position
2
AA seq 511 aa AA seqDB search
MGVEFEREDYLFLNELGISPENLGCYGGGVWRANGPTVTSVNPSDNKPIASVREASLEDY
EDSMRACAEARRMWMLTPAPKRGEIVRQIGDGLRDKLPLLGKLVSLEMGKILAEGIGEVQ
EFIDMCDYAVGLSRQLSGSIIPSERPNHAMMEVWNPLGIVGVITAFNFPCAVLGWNACIA
LVCGNCVVWKGAPTTPLVTLATTKVIAEVLERNKLPGGIFTCVCGGAEIGSAIAYDTRIP
LVSFTGSTKVGLLVQSIVHARHGKTLLELSGNNAIIVMDDAVLPLAVRAVLFAAVGTAGQ
RCTTCRRLIVHEKVYDDMLAGLLKAYKQVKTGNAVDETTLCGPLHSKHSKACFEEGIKKI
KAQGGKILTGGSVIDRDGNFVEPTVVEISHDAEIVREELFGPVLYVFKIKSLEEAIELNN
SVPQGLSSSIFTRNPETIFTWIGPTGSDCGIVNVNIPTNGAEIGGAFGGEKATGGGREAG
SDSWKQYMHRATCTINYGNDLPLAQGINFGG
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgggagttgaatttgagagagaagattacctgttcctgaatgaattgggtatttctcct
gagaatctgggttgctacggaggtggtgtgtggcgagcaaacggtcccactgtaacgtct
gtcaatccatctgacaacaagccaattgcatctgtcagagaggcttcacttgaagactat
gaagacagtatgagagcctgtgccgaagcacgtagaatgtggatgctgactccagctcca
aagaggggcgaaatagttcgtcagattggggacggtctaagagataaactcccacttttg
ggtaagcttgtctctcttgagatgggcaagattttggctgaaggcatcggagaagtacag
gagtttatagatatgtgtgactatgcagttggattgagtcggcagctcagcggttccatt
ataccttctgaacgtccaaatcacgccatgatggaggtgtggaatccattgggtatagtt
ggagtaatcactgcattcaattttccttgcgccgtactcggatggaatgcatgtatcgct
cttgtgtgtggcaactgcgttgtatggaagggagcaccaacaacgccactggtgaccttg
gctacgactaaagttattgctgaggttttggagcgaaataaactacctggtggcattttc
acctgtgtatgtgggggtgctgaaattggtagtgccatcgcatatgacactcgtatccca
cttgtgtcattcactggtagcaccaaggtgggattgttggtgcaaagtattgtgcatgca
aggcatggcaaaaccttgctggagcttagtgggaacaatgcaataattgtgatggacgat
gcagtcttgccactggctgtacgtgctgttttgtttgcagctgttggtactgccggtcaa
cgttgtaccacctgccggcgcctgattgtgcacgagaaagtctatgatgacatgctggcg
ggtctgctgaaggcatacaagcaagttaaaactggaaatgcagtagatgaaaccacattg
tgtggaccccttcattccaagcactctaaggcatgcttcgaagagggtattaagaaaatc
aaggctcagggcggcaaaattttgactggtggctctgtgattgatcgtgatggcaacttt
gtcgaaccgactgtagtcgagatatcacatgatgcagaaattgtgagggaagaattgttt
ggtcccgtcctgtatgtcttcaaaatcaagtcgttggaggaggccattgagctgaacaac
tcagtgccacagggcctcagcagctctattttcactcgcaacccagaaacaattttcact
tggattggacctacaggcagtgattgtggtattgtcaatgtgaacataccaaccaatgga
gcggagattgggggagcattcggtggagagaaggcaacagggggcggaagggaagcgggt
agtgattcatggaagcaatacatgcaccgtgcaacctgtactatcaattacggcaacgat
ctaccgttggcacagggtataaatttcgggggttaa

DBGET integrated database retrieval system