KEGG   Physcomitrella patens subsp. patens: 112279299Help
Entry
112279299         CDS       T01041                                 

Definition
(RefSeq) eukaryotic translation initiation factor 3 subunit A-like
  KO
K03254  translation initiation factor 3 subunit A
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
ppp03013  RNA transport
Brite
KEGG Orthology (KO) [BR:ppp00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    112279299
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:ppp03012]
    112279299
Translation factors [BR:ppp03012]
 Eukaryotic type
  Initiation factors
   eIF-3
    112279299
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PCI
Motif
Other DBs
NCBI-GeneID: 112279299
NCBI-ProteinID: XP_024369366
Position
3
AA seq 1013 aa AA seqDB search
MSTFAKPENALKRAEELMNVGQKQAALQALHDLITSKRYRAWQKTLEKIMFKYVELCVDM
KKGRFAKDGLIQYRIVCQQVNVSSLEEVIKYFLQLSSERAEQAQAQAAAAEVTLDVEDLE
AEKRPEDLMLSYVSGERGKERSDRETVTPWFKFLWETYRTVLEILRNNSKLESLYAMTAH
RAFQFCLQYKRTTEFRRLCEILRNHLINLNKYRDQRDRPDLTQPESLQLYLDTRFEQLKI
ATELELWQEAFRSIEDIHGLMTMVKRTPKPQMMAVYYAKLTQIYWMSDNHLYHAYAWYKL
YNLQKSYNKNLTAKDLQLMASSVVLATLAVPPYDRKHGAPHSELEIEKDRNIRMANILGF
SIDAKKDSREVLSRAALLSELVAKGVMTYVSPEVKDLFTLLENEFHPLDLAAKANAFIVR
LPSLSDKLTPASPVPEVRLEQYVPALERLTTLRVFQQASQVYSTIRIPELTRMVTFFDFS
TVEKLIVEAVKYNYVQMKVDHMMGVVNFGSQDLESEKVKTHLTILAKRLKKACIMISPPF
EEKASRQILPYAELQALVEKEHKKLLARKVLIERRKEEQERHMLEMEREEESKRLKQLRL
TEEAEAKRLANESARREEARIRKEIEEKELEEARAMLAEAEKRKGKKGKKGITDGEVSKL
SKQHLMEEALSEQIKERQEMERKLQKLSKTMDHLERAKREEERPLIEEAYRKRLQDDEKF
YQEQQEQALEQSKKQHDTDVVEKNRLIRMAEDKEIFEEQVISRRQGEFARLRRLREERLR
EERAMRSLDRQIRRKKEYFRRQEEARLLKIKEEEEARKREEEERKRKEEAERRAKFEELA
AKQREREIAAEERQKREREEALRPKLDVKPGKFVPPSLRKRMESGNDTRRVGEDRDARPP
VEERRPVFVSARVAPRETDRHMERDAASPLSTDRYQPPRARQSDAADSPPPPRAYELPVR
RSYGAPGARGDTYEPPRAGARGDAYAPPGRTDRRPVIGGEREREDRQERRDRW
NT seq 3042 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacttttgcgaagcccgagaatgccctcaagcgagcggaagagttgatgaacgtt
ggccagaagcaagctgctttgcaagctctccacgatcttatcacttccaagaggtatcga
gcatggcagaagacactagaaaagattatgttcaagtatgtggagctgtgtgtagatatg
aagaagggcagatttgcgaaggatgggcttattcagtacagaatagtatgtcagcaagtt
aatgttagttctctggaagaagtaatcaagtacttccttcagctgtctagtgagcgggct
gagcaagcacaagcccaagcagcagctgctgaggtaactttagatgtggaggatttagag
gccgagaaaaggccagaagatttgatgttgagttatgtcagtggcgagaggggcaaagaa
cgatcagaccgcgagaccgtgactccttggtttaagtttttgtgggagacttaccgtaca
gttttggagattttgcggaacaattcaaagttggaatccttgtacgctatgacggctcac
cgggctttccaattctgtcttcagtataagcgtaccactgagtttcggcgcctctgcgaa
attcttcgcaaccatctcattaacctgaacaagtacagagatcagcgtgataggcctgat
cttactcagccagaaagtttgcaattgtacctggatactaggtttgagcagctcaagatt
gccactgagctggagctttggcaggaagcattccgttcgatagaagacatccatggactg
atgacgatggttaagagaacacccaagcctcaaatgatggctgtgtattatgccaaattg
actcaaatatattggatgtccgacaatcacctgtaccatgcatatgcatggtacaagctt
tacaatttgcagaagagttacaataagaatcttacagctaaggatttacaactgatggct
tcttctgttgtgttggcaactctcgctgttcctccctacgaccgtaaacatggtgctccc
cattctgagttggagatagagaaggacaggaatattcgcatggccaacatccttggtttc
agtatagatgcaaaaaaagattctcgggaagtgctctcaagggcagctcttctttctgaa
ttggttgcgaaaggtgtgatgacttatgtgtcaccggaagtgaaggatttatttacattg
ttggagaatgagtttcatcctcttgacctcgctgctaaagcgaacgcttttatcgtgagg
ctcccgagcctgagtgacaagttaactccagcatcgcctgttccagaagttcgtttggag
caatatgttccagctctcgaaaggttgacaactcttcgagtttttcagcaggcttcacaa
gtgtactcgaccatccgaatacctgagctaacccgaatggtgaccttttttgatttctcg
actgtggagaagttgattgtggaggctgtcaagtacaactatgtgcaaatgaaggttgat
catatgatgggcgttgtaaacttcggcagtcaggatttggaatccgagaaagtgaaaaca
catcttactattcttgcgaagaggttaaagaaagcctgtattatgatctctccacctttt
gaggagaaagcgtctaggcaaattcttccttatgctgagcttcaagctctcgtggagaaa
gagcataaaaagttgcttgcccgtaaagttctgattgagcgccgtaaagaagagcaggag
cggcatatgcttgaaatggaaagagaagaggagtcgaagagattgaagcagctacgtttg
acggaggaagccgaggcaaaacggcttgcaaacgagtcagcaaggcgagaagaggccaga
atcaggaaagaaattgaagaaaaggaacttgaagaagcaagggcgatgctcgcggaggct
gagaagcggaaggggaagaaaggcaagaagggtattacggacggagaagtttccaaactc
tcaaaacagcatcttatggaagaggctttgagtgagcaaattaaagagcggcaagaaatg
gaacgcaagcttcagaagctctccaaaaccatggatcatttggaacgtgctaagcgagag
gaagagagacctctaattgaagaggcttaccgcaagcggctccaagatgatgagaaattt
tatcaggaacaacaggagcaagcacttgagcagagcaagaagcagcatgatacagatgtg
gttgagaagaacaggttgattcgtatggcggaagacaaggagatttttgaagaacaagtc
atcagccgtcgacaaggagaattcgccaggttgaggcgtttacgtgaggagagactcagg
gaggagcgagccatgaggtcactggaccgtcagattagacgcaagaaagagtactttaga
agacaagaagaagcgcgacttctgaagatcaaggaagaagaggaggctagaaagagggaa
gaggaagaacgcaaacgcaaagaggaggctgagcgtcgtgccaaatttgaggaattagct
gctaaacagcgtgagagggagattgccgctgaagaaaggcagaagcgtgagagagaagag
gctttgcgacccaagctcgatgtcaagcctggaaaatttgttcccccttcacttcggaag
aggatggagagtggtaacgacacgcggcgtgtgggtgaagacagagacgcccgtccgcca
gtagaagaacgtcgccctgtgtttgtgtcagcacgcgtggctcctcgtgaaactgatagg
cacatggaaagagatgctgctagtccactttccacggatcgctaccaacctccccgagct
cgccagtctgatgctgcggattctcctcctcctccaagagcttatgaacttccagttcgt
cgaagctatggtgctcctggtgcaagaggggatacatatgagcctcctcgggctggggct
cgtggcgacgcgtatgctcctcccggtcgtacagacaggcgtcctgttattggcggtgag
cgcgagcgtgaagatcgtcaagagcgtcgtgatcgttggtaa

DBGET integrated database retrieval system