KEGG   Physcomitrella patens subsp. patens: 112279602Help
Entry
112279602         CDS       T01041                                 

Definition
(RefSeq) probable mediator of RNA polymerase II transcription subunit 37e
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
ppp03040  Spliceosome
ppp04141  Protein processing in endoplasmic reticulum
ppp04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:ppp00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    112279602
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    112279602
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112279602
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ppp01009]
    112279602
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:ppp03041]
    112279602
   03009 Ribosome biogenesis [BR:ppp03009]
    112279602
   03110 Chaperones and folding catalysts [BR:ppp03110]
    112279602
   04131 Membrane trafficking [BR:ppp04131]
    112279602
   03051 Proteasome [BR:ppp03051]
    112279602
   03029 Mitochondrial biogenesis [BR:ppp03029]
    112279602
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ppp04147]
    112279602
Protein phosphatases and associated proteins [BR:ppp01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     112279602
Spliceosome [BR:ppp03041]
 Complex B
  Other components
   Prp19 complex
    112279602
 Complex C
   Prp19-CDC5 complex
    112279602
Ribosome biogenesis [BR:ppp03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    112279602
Chaperones and folding catalysts [BR:ppp03110]
 Heat shock proteins
  HSP70 / DNAK
   112279602
Membrane trafficking [BR:ppp04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    112279602
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    112279602
Proteasome [BR:ppp03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    112279602
Mitochondrial biogenesis [BR:ppp03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    112279602
Exosome [BR:ppp04147]
 Exosomal proteins
  Proteins found in most exosomes
   112279602
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C Zincin_2 Hydantoinase_A
Motif
Other DBs
NCBI-GeneID: 112279602
NCBI-ProteinID: XP_024369980
Position
3
AA seq 650 aa AA seqDB search
MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
QVAMNPTNTVFDAKRLIGRRFSDASVQSDMKLWPFKVTPGAADKPMISVQYKGEEKTFAA
EEISSMVLIKMKEIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVLRIINEP
TAAAIAYGLDKKASSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD
NRMVNHFVQEFKRKYKKDISSNPRALRRLRTAAERAKRTLSSTAQTTIEIDSLYEGVDFY
STITRARFEELNMDMFRKCMEPVEKCLRDAKMDKSSIHDVVLVGGSTRIPKVQQLLQDFF
NGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLI
PRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERARTRDNNLLGKFELSGIPPAPRGVPQI
TVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIEKMVQEAEKYKSEDEDHKK
KIEAKNSLENYAYNMRNTIRDDKIAANLDAADKKKIEDAVEAAIQWLDHNQLAESDEFED
KMKELESVCNPIIARMYQGGAGGAAGGAPSYGGDDDAAPSGAGPKIEEVD
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atggctggtaagggcgaaggtcctgctatcggcattgacttgggcactacctacagttgc
gtgggagtatggcagcatgatcgcgttgagattattgccaacgaccagggtaacaggact
accccgagttatgttgcattcacggataccgagcgacttatcggagatgccgccaagaat
caggtggccatgaatcccaccaacaccgtctttgatgccaagaggttgatcggaaggcgg
tttagcgatgcgtctgtacaaagtgacatgaagttgtggcctttcaaggttacacccggg
gcagccgacaagcccatgattagcgtgcagtacaagggcgaagagaagaccttcgctgca
gaggagatatcctccatggttctgattaagatgaaggaaattgccgaggcctacctcggt
tcgacaattaagaatgccgtggtcactgttcccgcgtacttcaacgactctcagaggcag
gccaccaaggacgccggagtgattgctgggttgaatgtgctgcgtatcatcaatgagcca
accgctgccgctattgcgtacggtttggacaagaaagcgtcatccgtgggggagaaaaac
gtgttgatcttcgatctcggaggcggtacctttgatgtgtcccttttgaccatcgaagaa
ggtatttttgaggtaaaggccactgccggagatactcacctgggaggagaggacttcgat
aacaggatggtgaaccacttcgtccaggaattcaagcgtaaatacaagaaggatattagc
agcaacccccgtgcgctgaggagactgagaaccgctgctgagagggcgaagaggaccctc
tcctcaactgcccagaccacgatcgagatcgactctttgtacgagggcgtggacttctac
tctaccatcactcgtgccagattcgaggagttgaacatggacatgttcaggaagtgcatg
gagccagtggagaagtgcctcagggatgctaagatggacaagtcatccatccacgatgtg
gtgttggtcggaggatcgacccgtatccccaaggtgcagcaattgttgcaagacttcttc
aacggcaaggaattgtgcaagtccatcaaccccgacgaggcggtggcgtatggagcggcg
gtgcaggctgccatattgtctggagagggtaacgagaaggtccaggatctattgctcctg
gatgtcactcctctgtctttgggtctggagaccgcaggaggggtgatgacggtattgatt
cccaggaatacgacgatcccgacgaagaaggagcaggtgttctctacctactctgacaac
cagcccggagtgttgatccaagtgtacgaaggagagagggcaagaacgagggacaacaac
ttgctaggaaagtttgaattgtccggaatccccccggctccccgtggtgtgccccagatc
acagtgtgcttcgatatcgatgcaaacggtatcttgaacgtgtcggctgaggacaagact
accgggcagaagaataagatcaccatcaccaacgacaagggccgtctgtcgaaggacgaa
atcgagaagatggtccaggaagccgagaagtacaagtctgaggacgaggaccacaagaag
aagatcgaggcaaagaatagccttgagaactacgcctataacatgaggaacacaatcagg
gacgacaagattgcagccaacttggatgccgctgacaagaaaaagattgaggacgcagtc
gaggctgccatccaatggttggaccacaatcaattggcagagagcgacgaattcgaggac
aagatgaaggagttggagagcgtttgcaaccccatcatcgcgcgcatgtaccagggaggt
gcaggaggtgccgcgggtggtgccccctcgtacggaggagatgatgatgctgctccgtct
ggtgccggccccaagattgaggaggtcgactaa

DBGET integrated database retrieval system