KEGG   Physcomitrella patens subsp. patens: 112280398Help
Entry
112280398         CDS       T01041                                 

Definition
(RefSeq) acyl-coenzyme A oxidase 4, peroxisomal-like isoform X1
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
ppp00071  Fatty acid degradation
ppp00592  alpha-Linolenic acid metabolism
ppp01040  Biosynthesis of unsaturated fatty acids
ppp01100  Metabolic pathways
ppp01110  Biosynthesis of secondary metabolites
ppp01212  Fatty acid metabolism
ppp04146  Peroxisome
Module
ppp_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ppp00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    112280398
   00592 alpha-Linolenic acid metabolism
    112280398
   01040 Biosynthesis of unsaturated fatty acids
    112280398
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    112280398
Enzymes [BR:ppp01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     112280398
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acyl-CoA_dh_1 Acyl-CoA_dh_M Acyl-CoA_dh_N
Motif
Other DBs
NCBI-GeneID: 112280398
NCBI-ProteinID: XP_024371619
Position
3
AA seq 476 aa AA seqDB search
MIMELSVVREGTEEKCQRRLTRIHEHLKPTDAYSSSALERIPTLAIGLPPLDIRSAFPQA
TPASIFPESVSDYFQLDDLLSSEDVALRKRIRETMEKHVAPVMTKYWEKAEFPFECVPHI
SSLMVAGGTTKGYGCPGLSVLSSALAMSEIARVDASCSTFVLVHSSLCMATLAMLGSEEQ
KLKYLPGLARLDLIGCWALTEPGYGSDASSLNTTAKKVEGGWLLNGQKRWIGNATFADVA
VLFARNTQTNQINGFIVKKGTPGYRATKIENKIGLRMVQNGDIVMENAFVPDKDRLPGIN
SFADTNKVLAVSRIMVAWQPIGIAMGVYDICHRYLLERKQFGAPLAALQINQEKLVRMLG
NIQAMFLLGWRLCKIYEAGKMTPGQASLCKAWNTKRARETVALGRELLGGNGILADFLVA
KAFCDLEPIYSYEGTYEINALVTGREITKIAAIKPSGGKTKTTATSEGLVRNTTKN
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgattatggagctgtcggtggtaagagagggtacggaagaaaagtgccaacgcaggctg
acgcgtattcacgaacacctgaagcccacagacgcttattcatcttctgcgttggaacgc
ataccaactcttgctattggccttcctccattggatataaggtctgcattcccacaggcc
actccagcatcaatattcccagagtcagtatcagactattttcagcttgatgacttgttg
tcatctgaagatgttgcacttcgtaagcgcatccgagagactatggagaaacatgttgca
cccgtcatgaccaagtattgggagaaggcagagtttccgttcgaatgtgtgcctcatatt
tccagcctcatggtcgccggcggcacgactaaggggtacggttgtcctgggctgtctgtt
ttaagcagtgctttggcgatgtcggaaatagcacgagtggatgcaagctgctctactttt
gtgcttgtgcattccagcttgtgcatggctactcttgctatgttgggaagcgaggaacag
aaactcaaatacttgcccggccttgctcgccttgacctcattgggtgctgggcattaaca
gagcctggatatggaagtgatgcgagctcactaaatactactgccaagaaggtagaggga
ggatggcttttgaatgggcagaaacgatggatcggtaatgcaacttttgcagatgtagct
gttttgtttgcccggaacacacaaacgaaccaaataaatgggtttattgtgaagaaaggt
acacctggctacagagctacgaagattgagaataagattgggttaaggatggtacaaaat
ggtgacattgtcatggaaaacgcatttgtgcctgacaaagatcggcttcctggaattaac
tcgtttgcagataccaacaaggtgttggccgtatctcggattatggtcgcatggcaacca
attggcatagccatgggcgtatatgacatttgccatagatacctacttgagaggaagcaa
ttcggagcacctttggctgcccttcagatcaatcaagaaaaattagtgcggatgctagga
aatattcaagctatgtttctactcggctggcgtttatgcaaaatttatgaagctggaaag
atgacccctggtcaagccagtctttgcaaggcttggaatacaaagagagctcgggagaca
gtggcgctagggagagagcttctaggcggcaatggaatacttgcggatttcctcgttgct
aaggcgttttgcgacttggagccaatttacagctacgagggaacgtatgaaatcaatgca
ttagtgacaggtcgtgaaatcacaaaaattgcggctatcaagcctagtggaggaaagacc
aagactacggctacctcagaaggcttggtgcgcaacaccaccaaaaactga

DBGET integrated database retrieval system