KEGG   Physcomitrella patens subsp. patens: 112281128Help
Entry
112281128         CDS       T01041                                 

Definition
(RefSeq) guanine nucleotide exchange factor SPIKE 1-like isoform X1
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
ppp  Physcomitrella patens subsp. patens
Brite
KEGG Orthology (KO) [BR:ppp00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ppp04131]
    112281128
Membrane trafficking [BR:ppp04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    112281128
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHR-2 DOCK-C2
Motif
Other DBs
NCBI-GeneID: 112281128
NCBI-ProteinID: XP_024373097
Position
4
AA seq 1884 aa AA seqDB search
MGEIALNGHRFRRIPHPYSLQSTDLELLSNGNLEPWPHLKELLLSYTAEWVKDELKYGRY
ESVPPPTFENQIFEGPDTDVETELRLSNIRLGRHGDATNDEDPTTSGRFSQGLFSGRFSG
RSTASDVPDSTVSKAPKHYGGAPLPPYEPVFNWRATRGSVYGQRTPEIPSALSPSGGLRI
SVKVVSLNIQAGLVEPWYGTVCLYHREKREKLSEDFHFRCLPAEFQDEASGYQRKAIFSL
EAPSPAICLLVQLEKHVTEEGGVTPSVYTRKEPVHLTQREKQKLQVWARVMPFREPFSWS
TIPLFDANITGGVGGFSSSPTSSPLPPGILGSALMEASLDSDGKLIADSKTESASVPVLV
DVPGLHRVKENYTEEMLQDPKRKVHKPMKATLRLEIERLSNDDHEADCISECGSFGNGSY
DADSRSIGGASLSGRSTQGLEFTKALYNGHQKGSPVHRELHSSSGSSLELGRSEFRAVEF
RLGLKPEPLPQLLHCLYVYPQSVNLNRKRNLFIRIELRNDDSDIRKPPLEALYPRDADSS
MQKYAHSQIDANTKNVHFHDEFKVQLPAKLSREHHLLFTFFHVDLQMKLEAPKPVVVGYA
VLPLLFAAQVIRLDGTLPIARELYPNYLLDNVKDRLEYLDDGRTVFKLRSRLCSSLYPVN
ERIRDFFSEYDRHVLRTSPWGNELMEAINALKHVEASAMLQFLQPCLNMLLRMIGDGGET
LQVAAFRSMVCIISRVQAETSDGAERNRYLVHYLDFAFDDFGGRHDPVYPGLCSVWRSLA
RSKAKGYRVGPVYDDVLSMAWFFLELIVKSMALEQSRSYCEAVPPGEELPPLQLNDEVFK
SIGQLYDCLLTEVQERGKKGLILAKKLNSSLGFFCYDLLSVIEPRQVFDLVALYFNKFSG
VCLSAMHEYKLTFLRIICDHDLFVEMPGRDPSERCVCLDLPQMNYLASMLMQELFITFDH
EDPALKAKACRIFVQLLCKHEYDARYQTLDDKLYISQRYFPLIGLILDEMPVFYALSPAE
KREVLVCVLHILRFLDDASLMKAWQQNVARTRLFFKLLEECQELFEYKKAGADGLMGAMP
ANEQGDGPLQYSEKLSPAINHFLAEASRQDVRLTKSSPGAQWLVQQASPDSSTFWKRVSP
ISNSSSSPSQPHSLREALAQAQSAGRGGGRPLRESLHPMLRQKLELWEENLSAAVMLQLL
EIVEKFMAATAGQAVATDYSRLDCITSIITGFLGRSQPLPFWKAFLPVFKNLFAQHGAIL
MSRDNDRFLKQVAFHLLRLGVFRNESIRKRAVVGLLILVRTAFQYFKGLSRLRVLLTITL
SELMSDVQVTQHRMDGSLEESGESQRLRRSLRQIAQENINADLLRECGLPEDTLSIMPEG
EFEQSWSWTGVAELSSTLLKAVEAAVGHALLGPEVMTTDKYATAEAYYGLARAYSNVPDL
HIMWLLYLCEVHQGNQSYAEAAQCAVAVAGVIMQAIVGKGDHMWGKEHVEALRKICPMLT
GASFGEAASAEIEGYGSSKLTVESAVKYLQLANKLFVQGELFHFCAGILELIIPVHKARR
AYGQLSKCHTSLTSIYEAIVEQESSPIPFTDATYYRVGFYGKSFGSLNCKEYVYREARDV
RLGDIMRSLGNIYEPRVIDGKQSLHIIPDSRQVKVNDLQPEICYLQITSVEPVTEDEDLE
CRRERQSCRSAATVSARVYNRFLFDTPFTKNGRSQGGLEDQWKRRTVLWTEGPFPALVNR
LTVVKSESREFSPIENAIGMIETRTAALAGELDDHRLNEGDHLPRLQSLQRILQGSVAVQ
VNSGVLGVCAAFLSGEPATRLKPQELQQLIAALLEFMAVCKKAIRVHARLIGEEDQEFHS
QLVIGFQSLTAELSRFIPSIPSDL
NT seq 5655 nt NT seq  +upstreamnt  +downstreamnt
atgggtgagattgccctgaatgggcatcggtttaggcgtatcccacatccttactctttg
cagtcaacagacctcgagctcttgtcaaatgggaatttggagccatggccacatttaaag
gagctgcttctaagctacactgcagaatgggtaaaggatgaacttaagtatggacgctat
gaaagtgtgccaccccctacgtttgagaaccagatctttgaagggcctgacactgatgta
gagacagagttacgcctttcaaatataagacttggaaggcatggggatgccacgaatgat
gaagatccgacaacttcaggaaggttttctcaaggattattttctggtcgattttctgga
aggtcaacagcaagtgatgttccagattcaactgtttctaaagcaccgaagcactatggt
ggagctcccctccctccatatgagccagtcttcaattggcgtgcaacgaggggatctgta
tatggtcaaaggacacctgagattccatcagcactatcaccaagtggcgggctgaggatt
tctgtgaaggttgtgtctctaaatattcaggctggtcttgttgagccgtggtatggtacg
gtgtgtttgtatcaccgggaaaagcgagaaaaactgtcggaggattttcacttccgatgt
ttaccagcagagtttcaagatgaggctagtggctatcaacggaaagctattttctcgctt
gaggcaccgtcaccagcgatctgcttgttggtgcagcttgagaaacatgtcacagaagaa
ggaggtgttactccttctgtctatacgcgtaaagagcctgtacatttgactcaaagagaa
aagcaaaaattgcaagtatgggcaagagtgatgccgtttcgcgaacctttctcttggtcg
actataccactttttgatgctaatataactggaggtgtggggggtttctcgtcatctcca
acaagcagtcctctgccgccgggcattttggggtcggctcttatggaggcatcacttgat
tcagatggcaagttgattgctgactccaagaccgaatctgctagtgtcccagttctggtt
gatgtaccagggcttcatcgtgtaaaagagaattatacagaagagatgcttcaggaccct
aagcgcaaagtacacaagccaatgaaggcaactctacggcttgagattgaaaggctgtcc
aatgatgatcacgaggcggactgcatctctgagtgtggcagcttcggtaacggctcctac
gatgctgattcccgttcaatagggggagcttcattatcagggcgttctactcaagggcta
gagttcacgaaggcgttgtataatggacatcagaagggcagccctgtgcatcgtgaactt
cattcaagcagtggaagtagtcttgagttggggcggtcagagtttcgcgctgttgaattt
cgacttggtctgaaacctgagccattgcctcaactattgcattgtctgtatgtttatcct
caatctgtgaaccttaatcggaagcgaaatctcttcattcggatagagctcagaaacgat
gacagtgatattcggaagccacctctcgaggctctgtatccaagggatgcagatagctca
atgcagaagtatgcacactctcagattgatgccaatactaagaatgtgcattttcacgat
gaattcaaagtccaactccctgccaaattgtcacgagaacaccaccttctcttcactttc
ttccatgtggatcttcagatgaaattggaagctccaaagccagtggttgtaggatacgct
gttcttcctctcttgttcgcggctcaggttattcggttagacggcactctgccaatcgcc
agggaattatatccgaactatttactagataatgtgaaggataggttggaatatcttgat
gatggtagaacagtatttaaactgcgctctcgtctatgctcatctctttaccctgtaaat
gaaaggatacgggattttttttctgagtatgatcgccatgtattgcggacaagtccctgg
ggtaatgaactgatggaggcaatcaatgcattgaagcatgtcgaagcatctgctatgcta
cagtttcttcaaccgtgtctgaatatgctactccgcatgattggtgatgggggagaaacg
ttgcaggttgctgcgttccgatcaatggtctgtataatctccagggtacaagcagagaca
tccgatggcgctgaacgcaatcgttaccttgttcattatttagactttgctttcgatgac
tttggtgggcgccatgatccagtgtatcccggtctctgcagtgtttggcgtagtcttgcc
cgcagtaaggctaaagggtatagagtcggacctgtatatgacgatgtcctctcaatggct
tggttcttcctggagttgatcgtaaagtcaatggcacttgaacagtctcggtcctactgt
gaggccgttcctccaggtgaagagttgccgccgctgcagctcaatgatgaggtttttaaa
agtattgggcagctttatgattgcttgctaacggaggttcaggagcgaggaaagaagggt
ttgattcttgccaagaaacttaatagtagtttgggcttcttctgctacgatcttctctct
gtaattgaaccacggcaagtttttgatttagttgcgctctacttcaacaaattttctgga
gtttgtctatcagcaatgcatgagtacaaacttacttttctacgtatcatctgtgaccac
gacttgtttgttgaaatgcctggtagagatccgtcggagaggtgtgtatgcctcgatctg
cctcaaatgaattacttggcatcgatgttgatgcaggagctatttatcactttcgaccat
gaagacccagccttgaaggcaaaggcatgtcggatttttgttcaactcttgtgcaagcat
gagtatgatgctcggtatcaaacactggatgacaaattgtatatttcacaacgttacttt
cctttgattggactgattttggatgagatgccagtattctatgccttgagcccggcagag
aagcgtgaagttttggtgtgtgtgctccacattttgcgcttcttggatgatgcttctctt
atgaaggcttggcaacaaaatgttgctcgaacaaggctattttttaaattactcgaagaa
tgtcaggagctgtttgagtataagaaagcaggagctgatggtttgatgggtgcaatgccc
gccaacgaacaaggagatgggccccttcagtattctgagaagctatctcctgcaatcaat
cattttcttgctgaagcttcacgacaggatgtcaggctcaccaagagctctcctggtgct
cagtggttagtgcaacaagcgagtccagacagcagcacgttttggaagagggtaagtccg
atttcaaacagctcaagcagtccaagtcagccgcattcattgcgtgaagctttggctcaa
gctcaatcagcaggaagagggggaggtaggcctcttagagagagcttacatcctatgctg
cggcagaaactggagttgtgggaagagaatctcagcgccgcagtcatgctgcaacttctc
gaaatcgttgagaaatttatggcggcaacagctggccaagctgttgctacggattactca
agacttgactgcattacaagcatcataactgggtttctagggcgtagtcagcccctaccg
ttttggaaagctttcctacccgtgtttaaaaatttgtttgcccaacatggggctattctg
atgagccgtgacaacgataggtttctgaaacaagttgcgtttcatttactacggctaggg
gtttttcgtaatgaatctattcgaaaacgtgctgttgtgggccttctaattcttgtgaga
acagctttccaatatttcaaagggctctctcgtctgcgtgtgttgctcacaatcacgctg
tccgagcttatgtcggatgttcaagtgacacaacatcgaatggatggatctttagaagaa
agtggtgagtcccaacgccttcgtagatcgctgcggcaaatcgctcaggagaacattaat
gcagatcttcttcgtgaatgtggacttcctgaagatacactatcaataatgccagaggga
gagtttgagcaaagttggagctggacaggagttgccgagctctctagcactttgcttaaa
gctgttgaggctgctgttggacatgctcttctgggcccagaagtcatgaccactgacaaa
tatgccactgctgaggcatactatggtctggctagggcatactccaacgttcctgatcta
cacattatgtggcttctctatctatgtgaagttcatcaaggcaaccagtcttatgcagaa
gcagcccagtgtgcagttgctgttgctggtgtcattatgcaggctattgtgggtaaagga
gatcacatgtggggcaaggaacatgtcgaagcattgcgaaaaatctgcccaatgcttacc
ggtgctagctttggagaagctgctagtgcagagatagagggctatgggtcatctaagctt
actgtggagtcagccgtaaagtatcttcagcttgcaaataaactttttgttcagggagag
ctttttcatttttgtgctggtattttggagcttatcattcctgttcataaagcaaggcgt
gcatacggacaactctcgaagtgccatacttctctgaccagcatttacgaagccatagta
gagcaagaatctagtccgatcccctttacggatgcaacttactatcgtgtgggtttctac
ggaaaaagttttggcagcctgaactgcaaggaatatgtttacagggaggcaagggatgtg
cgattgggggatattatgagaagcttgggaaatatttatgagccaagagtgattgatgga
aaacagtccttgcatattattcctgactctcggcaagtgaaggttaatgatcttcaaccg
gagatctgctacctgcaaatcacatctgttgagcctgttactgaggatgaggacctggaa
tgtagacgagagagacagtcctgcagatctgcggcaacggtgagtgctcgggtgtacaac
cgttttctgtttgatacccctttcacgaagaatggcaggtcgcaaggaggtctagaggac
caatggaaaagacgtacagttctttggacagaaggtcctttcccagctcttgtgaaccgt
ttaacagttgtgaagtcagagtctcgagaattttcgccaattgagaatgcgataggcatg
attgagacccgtacagctgccttagcaggggagctagatgaccaccgtttgaatgaaggt
gaccatctccctaggttgcaaagtctgcaacggatactgcaaggaagtgtcgcagtgcag
gtgaacagtggagtgcttggagtttgtgctgctttcttatctggggagcctgcaacaaga
ctcaagccacaggaacttcagcagctcatagcagcacttctggagttcatggccgtgtgc
aagaaagctatacgggtgcatgcaagacttattggggaggaggatcaagaatttcattcg
cagcttgtgattgggttccaatctctcactgccgagctctcacgcttcattccttccatc
ccgtcagatttgtga

DBGET integrated database retrieval system