KEGG   Physcomitrella patens subsp. patens: 112281628Help
Entry
112281628         CDS       T01041                                 

Definition
(RefSeq) stromal 70 kDa heat shock-related protein, chloroplastic-like
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
ppp03040  Spliceosome
ppp04141  Protein processing in endoplasmic reticulum
ppp04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:ppp00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    112281628
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    112281628
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112281628
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ppp01009]
    112281628
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:ppp03041]
    112281628
   03009 Ribosome biogenesis [BR:ppp03009]
    112281628
   03110 Chaperones and folding catalysts [BR:ppp03110]
    112281628
   04131 Membrane trafficking [BR:ppp04131]
    112281628
   03051 Proteasome [BR:ppp03051]
    112281628
   03029 Mitochondrial biogenesis [BR:ppp03029]
    112281628
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ppp04147]
    112281628
Protein phosphatases and associated proteins [BR:ppp01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     112281628
Spliceosome [BR:ppp03041]
 Complex B
  Other components
   Prp19 complex
    112281628
 Complex C
   Prp19-CDC5 complex
    112281628
Ribosome biogenesis [BR:ppp03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    112281628
Chaperones and folding catalysts [BR:ppp03110]
 Heat shock proteins
  HSP70 / DNAK
   112281628
Membrane trafficking [BR:ppp04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    112281628
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    112281628
Proteasome [BR:ppp03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    112281628
Mitochondrial biogenesis [BR:ppp03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    112281628
Exosome [BR:ppp04147]
 Exosomal proteins
  Proteins found in most exosomes
   112281628
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FtsA FGGY_C Hydantoinase_A
Motif
Other DBs
NCBI-GeneID: 112281628
NCBI-ProteinID: XP_024374118
Position
4
AA seq 707 aa AA seqDB search
MASAVGSVAFLPCSVAGQGSVVYKVRFSKHRKCTLRGQKPSDRAFFGGDFSISRSTQECN
SKHERSSRPLRVTAEKVVGIDLGTTNSAMAAMEGGQPTIITNSEGQRTTPSVVAYTKKGD
RLVGQIAKRQAVVNPANTFYSVKRFIGRKMNEVEDESKQVSYQVIRDSNGNVKLDCPAIN
KQFAAEEISAQVLRKLVDDASKFLSDKVDKAVITVPAYFNDSQRQATKDAGRIAGIDVLR
IINEPTAASLAYGFDKKKNETILVFDLGGGTFDVSVLEVGDGVFEVLSTAGDTHLGGDDF
DKRIVDWLAKEFKAAEGIDLLKDAQALQRLTESAEKAKIELSSLTQTTISLPFITATAEG
PKHIDTTLTRAKFEELCSDLLDRCREPVKRALDDAKLSLKDLQEVVLVGGSTRIPSVQQL
VKQMTGKDPNVTVNPDEVVALGAAVQAGVLSGEVGNIVLLDVSPLSLGLETLGGVMTKII
PRNTTLPTSKKEVFSTAADGQTSVEINVLQGEREFVRDNKSLGSFRLDGIVPAPRGVPQI
EVTFDIDANGILSVTAMDKGSGKKQDIQITGASTLNKDDVERMVQEAERNAEEDKKRREV
IDLKNQSDSMIYQAEKQLKELSDKVPADLKSRVETKVVDLKEAAKTEDVEKMKRAQEALQ
QEVMQIGQAIYGSGAAHAGPAQPGSGAASSPPGDDAEVIDADFTDST
NT seq 2124 nt NT seq  +upstreamnt  +downstreamnt
atggcatccgcggtgggatctgtggcattcttgccctgttcagttgcaggacaggggagt
gtcgtctacaaagttcgcttttcaaagcatcggaaatgcacattgcgtggtcagaagcct
tcggatagagccttcttcggaggggatttttctatttcaagaagtactcaggaatgcaat
tcaaagcatgaaaggagctcaaggcctcttcgtgtaactgccgaaaaagttgtcggcatt
gatcttggaacaacaaactctgcaatggcagctatggaaggtggacagcctacaataatt
actaattctgagggccagaggacaaccccttcggttgttgcgtacacgaagaaaggtgat
cgattagtggggcagattgctaagcgccaagctgtagtgaaccctgcgaacacattttac
tcagtcaagcgattcattggacggaaaatgaacgaagtggaagatgagtccaagcaagtt
tcttaccaagtcattcgagactccaatggtaatgtgaaactcgattgtccagcaatcaac
aagcagtttgctgctgaagaaatatccgcgcaggttctaagaaaattggtagacgatgcc
agcaagtttctaagcgacaaagttgacaaggctgttataacagtgcctgcttacttcaac
gacagtcaacgccaggctactaaagatgctggtcgaattgctggaattgatgtactgaga
atcatcaacgaacccactgcggcatcgttggcatatggtttcgacaagaagaaaaacgaa
actatcttggtctttgaccttggcgggggcacctttgatgtttcagtcttggaagttgga
gatggggtttttgaagtactttccacagcgggagacacccatctcggtggtgacgacttt
gacaagagaatagtggattggctggcgaaagaattcaaagccgctgaaggcattgacctc
ttaaaggatgctcaagcacttcagaggctgactgaaagtgctgaaaaagctaagattgaa
ttatcctccctcactcagacaactatcagtcttccttttattacagcgactgcggaggga
cctaagcacattgatacaacacttacacgtgccaagtttgaggagttgtgttcggatctc
ttagacagatgtcgtgagccagtaaagagagctttagacgatgccaagttgagtctcaag
gatttgcaggaagttgtcttggtgggagggtcgactcgaattcctagtgtgcagcaattg
gtcaagcagatgacaggaaaagatccaaatgttactgttaatcctgatgaagttgttgct
cttggtgcagcagttcaggctggagttctatctggtgaggttggtaatattgtgcttctg
gatgtttcgcctctatcgctaggactggaaactttggggggtgtcatgacaaagatcatt
cctcgaaatacgacactgccgacttccaagaaagaggtcttctctactgcggctgatggt
caaacaagcgtcgagattaatgtgctccagggagaacgtgagtttgtaagggataataaa
tcgctcggaagcttcaggttggatgggattgtacctgcaccacgtggagttccacaaatc
gaggtgacctttgatattgatgccaatggcattttatcggtcacagctatggacaaagga
tcaggaaagaagcaggacatccagataactggtgcctccaccctcaacaaagatgatgtg
gagagaatggtccaagaagcagaaagaaatgcagaagaagataagaaacgcagggaggtt
attgatttaaaaaatcagagtgatagtatgatttatcaggcagagaagcagttgaaggaa
ctgagtgacaaagttccagcagacctgaagagtcgtgtggaaacgaaggtggtcgatctc
aaggaagccgcgaagacagaggatgtggaaaaaatgaaaagagctcaagaagcgttacaa
caagaagtaatgcaaattggacaagcaatatatggaagcggcgctgcacacgcaggccct
gcacaacctggttccggagctgcttcatcacctcctggagatgatgctgaggtgattgat
gcagacttcactgattcaacgtga

DBGET integrated database retrieval system