KEGG   Physcomitrella patens subsp. patens: 112282916Help
Entry
112282916         CDS       T01041                                 

Definition
(RefSeq) sphingosine kinase 1-like isoform X1
  KO
K04718  sphingosine kinase [EC:2.7.1.91]
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
ppp00600  Sphingolipid metabolism
ppp01100  Metabolic pathways
Module
ppp_M00100  Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:ppp00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    112282916
Enzymes [BR:ppp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphingosine kinase
     112282916
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAGK_cat
Motif
Other DBs
NCBI-GeneID: 112282916
NCBI-ProteinID: XP_024376897
Position
1
AA seq 483 aa AA seqDB search
MEEVLNEQVVLDGKRVLVTLDSAAGVLQWRGERDGQLILQNDLIGFCSSESGICLYTFRM
TKSSSYCGKGLPGRKRKDMVVEFSNDGARRLWCDSLQRILDKAGRPKRLLVLVNPFGGRK
TGRKVFSASVEPLLKAAGITYTVKETQFQRHALDLAKESDLSQLDGIVCVSGDGVLVEVL
NGLLERSDWERAIKMPIGIIPAGTGNGLAKSVLDHVGEPCDAASATFLVIRAGQTQPLDV
ATAKQSNVKFHSILMLTWGLVADVDIESERLRWMGALRLDVYTLIRISNLRKYNGQLYYI
PAPGYEGTGTPLNEEFARTTLMTSGEANSDSSLQKHGDPGSLQKNFSEWREMEGPFILIW
LNNVPFVSESVNAAPNAKFADGYLDLIILKDCPRWALLNLLLKVQTGGHIKSKYVDYLKV
KTFRLDPVGRHASDVQGGYTDLDGEILARDKGSFGDGSNYPMSYGPPIEVTVEPGLATIF
CPP
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atggaggaggttttgaacgagcaagtcgtgttagatgggaagcgggtgctggttacgttg
gattcggctgctggggtgctccaatggcgcggagagagggatggccagttgattctgcag
aacgacctaattgggttctgtagctctgagtctggcatttgtttgtacacgttcagaatg
acgaagagctcgagttattgtgggaagggcttaccaggacggaaacgcaaggacatggtc
gtggagtttagcaacgacggggctcgcaggctttggtgtgattccctccagcgaattcta
gacaaagctgggcgaccgaagcggcttctagtgcttgttaacccttttggtggaaggaaa
actgggaggaaagtgtttagtgcaagtgtggagcctttactgaaagcggctggcatcact
tacaccgtgaaagaaacgcagttccaacgtcatgctttagacttggccaaagaatcggat
ctctcgcagttggatggcatcgtctgcgtcagtggagacggagtgttagttgaggtgtta
aatggtctgctggaaagatctgattgggagcgcgctattaagatgccgattggcatcatt
cccgctgggacgggaaatggtttggcgaagtcagtgttggatcatgtaggggagccttgt
gatgctgcaagtgctacttttctcgtcatccgagcagggcagacgcagccgcttgacgtt
gctacagcgaagcagtcaaatgtcaagtttcacagcattctgatgctaacatggggtctt
gttgctgatgtggacatcgaatccgaaagattgaggtggatgggtgcattacgtctggac
gtttacacgttgatcaggataagcaatctacggaagtacaatggacagctttactacatt
ccagcgcctggatatgaagggacagggacccctctcaatgaagaatttgcaagaacaacc
ttgatgacatctggtgaagctaacagcgacagtagcttgcagaagcatggggaccctgga
tccctgcaaaagaatttttcggagtggcgtgagatggagggtcccttcattcttatttgg
ctcaataatgtaccgttcgttagcgagtctgttaatgccgccccgaatgccaagttcgca
gacggatatctggacttaataattctgaaggattgtcctcgctgggctttgcttaactta
cttcttaaggtgcaaaccggaggacacatcaaatctaagtatgtggattacctcaaggtg
aagacgtttcgacttgatcctgttggccggcatgcaagtgacgttcaaggcggctacact
gacttagatggcgaaattcttgcacgagacaaaggctcatttggtgatggaagcaactac
ccaatgtcatatgggccccctatagaggttacggttgaaccagggttggcaacaatcttt
tgccccccttga

DBGET integrated database retrieval system