KEGG   Physcomitrella patens subsp. patens: 112283173Help
Entry
112283173         CDS       T01041                                 

Definition
(RefSeq) PTI1-like tyrosine-protein kinase At3g15890 isoform X1
Organism
ppp  Physcomitrella patens subsp. patens
Brite
Enzymes [BR:ppp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     112283173
Protein kinases [BR:ppp01001]
 Serine/threonine kinases: TKL group
  IRAK family
   112283173
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase APH PIP49_C
Motif
Other DBs
NCBI-GeneID: 112283173
NCBI-ProteinID: XP_024377337
Position
6
AA seq 351 aa AA seqDB search
MMATAVANDKTTWAARLSLSLCRPADGKKPGTWRRFSLRELHAATNNFNYDNKLGEGTIG
SVYWGQLASGDQIAVKRLKVWSTKAEREFAVEIEILGRVRHKNLLSLLGYCAEGQERLIV
YEYMPNLSLYSHLHGHLAADSALDWDQRMKIAVGSAEGLAYLHHYATPQIVHRGIKASNI
LMDENLNALVADFGLAKLIPNSSAQKGISGCTAPKTVAGKVTEACDVYSFGVLLMELISG
RKPIERVSGEKQAIMNWARPLILQGKIHDLVDAKLEGKFDKDHLNKLAQVAALCAEILPE
ERPSMQDVVEMLKEGTKDLMKPLLQDGDRFDEAAVNSVHPVGIDVNTLNIN
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgatggctaccgctgttgccaacgacaaaactacctgggcagcaagattgtccctcagt
ctgtgcagacctgcggacggcaagaaacctggaacatggcgtaggttttcattacgagag
ttgcatgcggccactaacaacttcaactatgacaacaaacttggagaagggactattggt
agcgtctactggggtcaacttgcgagtggcgaccaaattgcagtaaaaaggttgaaagta
tggagcacgaaagcagaaagagaatttgctgtcgaaattgaaattctcggtcgagtacga
cacaagaacctcctaagcctgttgggttactgcgcagaaggccaggaacgcttgatcgtg
tatgagtacatgccaaacttgagcctctactcgcacttacatggccacctcgctgccgac
tccgccttagactgggaccaaaggatgaaaattgcagttggctccgcagaaggccttgcc
tacttgcaccattatgccacgccacaaatcgtccaccgtggtatcaaagcgagcaacatt
ctcatggacgaaaacctaaacgccttggtggccgatttcggcttggcaaagctcattccc
aattcttcggctcagaagggcatctccggatgcactgctccaaagaccgttgcaggaaaa
gtcacagaggcctgtgatgtctacagttttggtgttctgctgatggagctcattagtggg
aggaagcctatcgaacgagtaagcggagaaaagcaagcaatcatgaattgggctcggcca
ttaatattgcaaggaaaaattcatgacttggttgatgctaagctggagggcaaatttgac
aaggaccatctcaacaaactagcccaggttgcagcactatgtgcagaaattttacctgaa
gagagaccgtccatgcaagacgttgtggagatgctgaaggaaggaaccaaagatctgatg
aagccgctgttgcaggatggggaccgtttcgatgaggctgcagttaacagtgtgcatcct
gtcggtatcgatgtgaacaccttgaatatcaactaa

DBGET integrated database retrieval system