KEGG   Physcomitrella patens subsp. patens: 112283413Help
Entry
112283413         CDS       T01041                                 

Definition
(RefSeq) succinate--CoA ligase [ADP-forming] subunit alpha, mitochondrial-like
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
ppp00020  Citrate cycle (TCA cycle)
ppp00640  Propanoate metabolism
ppp01100  Metabolic pathways
ppp01110  Biosynthesis of secondary metabolites
ppp01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ppp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    112283413
   00640 Propanoate metabolism
    112283413
Enzymes [BR:ppp01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     112283413
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     112283413
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-GeneID: 112283413
NCBI-ProteinID: XP_024377812
Position
6
AA seq 358 aa AA seqDB search
MEGIQIPYITWSLVKCVLHASTRMASGAARAMAQCVRAVTKSFTTTASRGFIDAGHARGM
SKAAVFVDKATRLIVQGITGKNGTFHTEQAIAYGTQVVGGVTPNKGGTQHLGLPVFNTVA
EAKQGVQANATVIYVPPKMACNAILEALDAELDLVVCITEGIPQQDMARVKAALLSQSKT
RLIGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTRVGLGQSTCIG
IGGDPFSGTSFVDCLRCFVKDPQTEGVVLIGEIGGSGEEDAARFIVSSGTQKPVVAFVAG
LTAPPGRRMGHAGAIIAGGRGTAQAKMKALRAAGVTVVESPAHLGKTILKVFRDRRLL
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atggagggcattcaaataccctatatcacatggagtctggttaagtgtgttttgcatgca
tcaactcgcatggcgagtggcgcggcgagggccatggcgcagtgcgtgcgagcggtgacg
aagagcttcaccaccacagcgtcgcgaggcttcatcgacgcgggccacgcgcgcggcatg
tcgaaggccgcggtgttcgtggacaaggccaccaggctgatcgtgcaaggcatcacgggc
aaaaacggcacattccacaccgagcaagccatcgcgtatggcacgcaggtggtgggcggc
gtgacgccgaacaaaggcggaacgcaacacctcggcttgcccgtgttcaacaccgtcgcc
gaagccaagcaaggcgtccaggccaacgccactgtcatctacgtgccacccaaaatggcg
tgcaacgccatcctggaggcgctggacgcggaattggacctcgtcgtgtgcatcaccgaa
gggatcccgcagcaggacatggcgagggtgaaagccgcattgctgtcgcagagcaagacg
cgcctgatcggccctaactgcccggggatcatcaagcccggcgagtgcaagatcggcatc
atgccggggtacatccacaagccaggccgcatcggtatcgtatccaggtcgggaactttg
acatacgaggcagtgtttcagacaaccagggtggggttggggcagtcgacgtgcatcggc
atcgggggcgatccattcagcggcaccagcttcgtggattgcttgcggtgctttgtgaag
gatccacagacagagggcgtggtgttgattggggagattggtggttcaggcgaggaagac
gcggcgcgcttcatcgtgagcagcggcacgcagaagcccgtggtggcattcgtggccggg
ctgacggcgcctccggggcggcgaatgggccacgcgggggcgatcatcgctgggggccga
ggcacggctcaggccaagatgaaggcgctgcgcgcggcgggcgtgactgtggtggagtcc
ccggctcacttgggcaagaccatcctcaaggtcttccgcgaccgtcgcctgctttga

DBGET integrated database retrieval system