KEGG   Physcomitrella patens subsp. patens: 112283558Help
Entry
112283558         CDS       T01041                                 

Definition
(RefSeq) methyltransferase-like protein 1
  KO
K05925  mRNA m6A methyltransferase [EC:2.1.1.348]
Organism
ppp  Physcomitrella patens subsp. patens
Brite
KEGG Orthology (KO) [BR:ppp00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ppp03019]
    112283558
Enzymes [BR:ppp01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.348  mRNA m6A methyltransferase
     112283558
Messenger RNA biogenesis [BR:ppp03019]
 Eukaryotic Type
  mRNA processing factors
   3' end processing
    N6-methyltransferase complex
     112283558
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MT-A70 N6-adenineMlase
Motif
Other DBs
NCBI-GeneID: 112283558
NCBI-ProteinID: XP_024378153
Position
6
AA seq 1309 aa AA seqDB search
MEGGCKSLLSEKVKCSSQVAHDEDSQDFKKLVARGEAEPGEGEGEGGGDNELKKPERNRR
EKERLEKEELDEWEKSTHYREKRSGNWSKEKCHFDHTQSRDKSEWRDLKVGNNLEGEREE
SGNKIPSLGRRRGRDTLEREDCDLGGRFLGGDDREGEREREQKKGRGMEWQRERDKGKER
ERERKRRDELYWNDQQHIGSERYDDRYCDLNGGGRSTVKGRENRGYRVKEKYRSRGTGRE
ELDDRHRRVSWDRREDERTGKLASKESTHGFMRDSAVAREKVDEDGSRRPRWDEEKGKKS
LSRDSIEEAKLSRSKVEDLVDKVHATEKDSGSDLPDDRCRLKGKHGRPVTSPQSPDDRRE
LYKGGTCAISSRSPDDRRDHRSSKAIANSRSPHDRRVERSDWEDVERDWSDGREEYDRAK
SCKKRGTHNRDYDSSEREHDRYRSREGTYDRSWERRKEIDKVDNAGRSYERHQNHRKGNR
DAVRGRDSNFQVEQDICESKKRHDIADREKPDGRMSERESSERNRMDRDLVERLRNTQGF
ASMSDSTGPGRQLPLNYAEPGRGFCSHGGPYMPSGDYFGGVGMIDWDGPTKDDRIPPREG
IFLRGDDRFMDNDYPVGHDPDYGPGRGAAGDGGMSCNPHPGRGRGSKVLPNNRGRGGMLG
HEGRLLFNNNHSGPMLRGMQHQQQLQCGKMRGPRGGPKGARGHCRELQRPSVNPLLMGPG
ISPRYGPMGPQGLMPGMKMGPGSGPGPTPGPNLSQIPLLPFGGPMFWGIGPGSIDVGMMG
CPPGHAPVIGPGPGGLGPRFGPGIVPGPGSKMFFNPPGPGRGSHGVMSIVSFGGSAPPFS
GQSGGGGRGQISDRGPPGGGRGLVGRASGLPGRGPSRGEQNDYSQHFVDTGLQPQNFIRD
VELADRFEEFPKLKELITRKDQLIAKRATPPMYMQYDLRTTDLSPDVFGIKFDLILVDPP
WEEYVRRAPGIGHSMEWWSAEEIQNLRIEAIADTPAFIFLWVGDAEGLEQGRLCLKKWGF
RRCEDICWVKTNRENPTPALRHDSNTLFQHSKEHCLMGIKGTVRRSTDGHIIHANVDTDI
IISEDPEYGSTQKPEELYHIIEHFAQGIRRIELFGEDHNIRSGWVTVGKGLTSSNYNPQT
YAKNFTDLEEKVWQGARGNPVIDAPHLVGTTPEIEALRPKSPPPRPQAQPFGQGYGGNSL
SQPSAGNSVSKKTSTEQAGGIQNGHPVALIPGAGHGSVNPPGTGSVVIGQSPHAGGRGGG
HGQIPKICPILPGPLTKAQGAAPGIVRSGGDVQEATSAEDVLHCHHIND
NT seq 3930 nt NT seq  +upstreamnt  +downstreamnt
atggaaggaggatgcaaatctctacttagcgagaaagtaaagtgtagttcgcaggtagcc
catgacgaggattctcaggattttaagaaactggtagctcgtggagaagcggaaccagga
gaaggagaaggagaaggaggtggtgataatgagctaaagaaacctgaacggaatcgcagg
gagaaagagagactggaaaaggaggaattggatgagtgggagaaaagtacacattacaga
gaaaaaaggagtggaaactggtcgaaggaaaaatgccattttgatcacactcagagcaga
gacaagtcagagtggcgagatcttaaagttggaaacaatcttgaaggtgaaagggaagag
tcaggcaacaagatacctagtttaggacggcgacgtgggagagatacactggaaagagaa
gattgtgatttagggggcagatttttgggaggggatgacagagagggggaacgggaaaga
gaacagaaaaaggggagaggaatggaatggcagagagagagggacaaagggaaagagaga
gaaagagagcggaagaggagggatgagctttattggaatgatcagcaacacataggttct
gaacgttatgacgacaggtattgcgacctaaacggtgggggaaggtctaccgttaaggga
agagaaaatagaggatatcgtgtgaaggaaaagtatagatcacgaggaacaggtcgagag
gagctggatgatagacacagaagggtgagttgggacagaagggaagatgaaagaacaggg
aagttggcttccaaggagtctacgcatggcttcatgcgggatagtgctgtggctagagag
aaggtagacgaagatggcagtaggagaccaaggtgggatgaagagaaagggaagaaatca
ctttcgagggattcaattgaagaggcaaagttgagtagaagtaaagttgaggatctcgta
gataaggtccatgcaactgaaaaggatagtggttcagatttgcccgatgaccggtgcagg
ttgaaaggaaagcatggaagacctgtgacgtcccctcagagccccgatgatagaagagag
ctttacaaaggcgggacgtgtgcgatatcatctcgaagtcctgatgatcggagagatcat
agaagtagcaaagctatcgcaaattctcgtagtcctcatgatcgaagagtagagcgatca
gattgggaggacgtagagcgggactggtcagatggtagagaagagtatgacagagcgaag
agctgcaaaaaacgcgggactcataatagggattacgacagcagcgagagagagcatgac
aggtatagaagtagagaagggacttatgatcggagctgggaaagaagaaaagaaatagat
aaggtggataatgcaggccgatcctatgaacggcatcagaatcacaggaaaggtaatagg
gatgctgtaaggggcagagattcaaatttccaagtggagcaagatatttgcgagtcgaaa
aagagacatgatattgctgatagagagaagccggatgggcggatgtcggaacgagagagc
agcgaacggaaccggatggaccgggacctagtggagagattgagaaatacgcagggattt
gcttcgatgagtgatagcactgggccaggccgccaattgcctctcaattatgcagagcct
ggacgtggattctgctcccatggaggtccttacatgccatcaggtgattactttggcggt
gtggggatgattgattgggatggcccgacgaaagacgatagaataccaccaagagaaggt
atctttctgagaggcgacgatcggtttatggacaatgattatccagtaggccatgatcca
gattatggtcccgggagaggagctgcaggcgacggagggatgagctgcaatccccatccc
ggtagaggccggggttcaaaagtcttaccgaacaatagaggtcggggaggcatgttgggc
cacgaaggaagacttcttttcaataacaatcattctggtcccatgctcagagggatgcaa
catcagcagcaactacaatgtggtaagatgcgaggtcctagaggtggaccaaaaggtgcg
agaggtcattgccgggaattgcagcggccgagcgtcaatcctcttctcatgggtccagga
attagccctcgctacggtccaatgggtcctcaaggattaatgcctggtatgaaaatggga
ccaggatcagggccgggtccaactcctggtcccaacctgagccaaattcctttgcttcca
tttggagggcccatgttttgggggatcggtcctggaagtatcgatgtgggaatgatgggg
tgcccaccaggccatgctccagtgataggtcctggtcctggtggcctgggtccaagattt
gggccaggtatagttccaggcccaggatctaagatgtttttcaatccgcctgggccaggg
agaggaagtcatggagttatgtctattgtttcatttggtggaagcgcaccacctttcagt
ggacaaagtggtggaggaggacgaggccaaattagtgacagaggtccacctgggggtgga
aggggattagttggaagggcaagtgggctaccaggaagaggtccttccagaggagaacaa
aacgattactctcagcattttgttgatacaggtttgcaacctcagaacttcattcgagat
gtggaacttgccgatcgattcgaagagttcccaaagctgaaagagctgataactaggaag
gatcaactcatcgcaaagagagcaacacccccaatgtacatgcagtatgatcttcgaaca
acagatttgtcccccgacgtatttgggatcaagtttgatttgatacttgtggatcctcct
tgggaggagtatgttcgtcgagctccaggcattggacattcaatggaatggtggtcagct
gaagagattcaaaatcttcgtattgaggctattgcggatacacctgcattcattttctta
tgggttggggatgctgaaggtctcgagcaagggcgtttgtgtcttaagaagtgggggttc
cggagatgtgaggacatatgctgggtaaaaactaaccgggaaaatcctactccagccctg
cgtcacgactccaacactctatttcaacactctaaagagcattgcttgatggggataaaa
gggacagtgaggcgcagcaccgatggtcatattatacatgcgaatgtggacacggacatc
ataatttcggaagacccagaatatgggtctacacagaagcccgaggagctatatcatatc
atcgaacacttcgcacaagggatacggcgcatcgaattatttggagaagaccataacatc
cgatctggatgggtcaccgtagggaagggcctcacttcatctaattacaatcctcagaca
tatgctaaaaatttcactgatttagaggaaaaagtttggcaaggtgcccgtggcaatcct
gtgattgacgctcctcatctagttggaactactccagaaattgaagctttacgccccaag
tctccacctccaagacctcaagctcagccattcggacagggttatggtgggaattctctc
tcacagccttctgcggggaactccgtttcgaaaaagacctccacagaacaggcaggtggt
attcagaatggacaccctgtcgcgctaatacctggtgctggacatggttctgtcaatcca
ccaggaacaggatctgttgtgattggacagtctcctcatgcgggtggtcgtggaggagga
cacggtcaaattcccaaaatttgccccatccttcctgggcccttgacaaaggcacaagga
gctgccccaggtatagttagatcggggggagacgtgcaggaagcaacctcagcggaggac
gttcttcactgtcaccacataaatgattga

DBGET integrated database retrieval system