KEGG   Physcomitrella patens subsp. patens: 112283655Help
Entry
112283655         CDS       T01041                                 

Definition
(RefSeq) probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH5
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
ppp03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:ppp00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    112283655
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:ppp03041]
    112283655
Enzymes [BR:ppp01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     112283655
Spliceosome [BR:ppp03041]
 Complex C
  Other components
   Step II factors
    112283655
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HA2 OB_NTP_bind Helicase_C S1 DEAD AAA_22 AAA_30 AAA_19 T2SSE DUF2075 AAA_16 ABC_tran PhoH Sigma54_activ_2 Flavi_DEAD
Motif
Other DBs
NCBI-GeneID: 112283655
NCBI-ProteinID: XP_024378459
Position
1
AA seq 1219 aa AA seqDB search
MDGLKRLEYLSLVSKVCTELEAHIGCSDKTLAEFIVDLAQKCETVEQFGKLLKANGAEMP
EYFVKTLLTIIHAILPPVSKAERERLSKGLGGDKDLKRTAFPGLAVPDSKQRVRELEEEL
EADGVGVRVSEGRREERGSAKDDGRGGESDDGVRDRDHRRDREKDSVRVRDGGGERDGRR
DARGKPYDREDRRGNGGGRAREKERGGRDKDDVSGWRNNDRYGGESGRGRGRDREVDYED
GDRVGPSSGSVVPSRAPVVDEPELYGIYKGRVSRIMDYGCFVQLLGVRDRKEGLVHVYNI
ASRRVVNAKDAVERDQEVWVKVLSVSDKKISLSMRDVDQKTGEDLLPMKRTTTEEENLRA
NPSSSSLAPEMRKGLSGITIVEEEDNTSNRRPMKRMSSPERWEAKQLIASGVLGVRDYPM
YDDDGGGMLYHDEGAEEELEIELNEDEPAFLRGQTRYSVDVSPVKIVKNPDGSLQRAAMT
QSALAKERRELREQQQRTMLDSIPKDLNRPWEDPMPETGERHLAQELRGVGLSAYDMPEW
KKDAFGKAPTFGQRSKLSIQEQRQSLPIYKLKNELIKAVHDNQVLVVIGETGSGKTTQMT
QYLAEAGYTTRGKIGCTQPRRVAAMSVAKRVAEEFGCRLGEEVGYAIRFEDCTGPETVIK
YMTDGMLLREILIDEMCASYSVIMLDEAHERTIHTDVLFGLLKGLVKRRPDLRLIVTSAT
LDAEKFSRYFFDCPIFTIPGRTYPVEILYTKQPETDYLDAALITVMQIHLTEPEGDVLLF
LTGQEEIDTACQILYERMKGLGPNVPELIILPVYSALPSEMQTRIFEPPPPGTRKVVVAT
NIAEASLTIDGIYYVVDPGFAKQNVYNPKLGLDSLVITPISQASARQRAGRAGRTGPGKC
YRLYTESAYRNEMLPTTVPEIQRVNLGLTTLTMKAMGINDLLSFDFMDPPPPQALISAME
QLYSLGALDEEGLLTKLGRKMAEFPLEPPLSKMLLASVDLGCSDEILTIISMVQAQNIFY
RPREKQAQADQKRAKFFQVEGDHLTLLAVYEAWKAKNFSGPWCFENFVQSRSLRRAQDVR
KQLLTIMDRYKLDVVSAGKNFTRIRKAIAAGFFFHAARKDPQEGYRTLVENQPVYIHPSS
ALFQRQPDWVIYHELVMTTKEYMREVTLMDPKWLVELAPRFFKVADPTKMSKRKRQERIE
PLYDRYHEPNSWRLSKRRA
NT seq 3660 nt NT seq  +upstreamnt  +downstreamnt
atggacgggttgaagaggttggagtatctgtctcttgtgtcgaaggtttgcacggagttg
gaggcacacataggctgcagcgacaagaccttggcggagttcatagtcgacttagcgcag
aagtgcgagacggtggagcagttcgggaagttgctcaaggccaacggtgccgagatgcca
gagtatttcgtaaagacgttgttgacgattattcacgctatcttgccgccagtgagcaag
gcggagcgggagaggttgagcaagggtttaggcggggataaggacttgaaacggactgca
tttccagggttggcagtgccggatagtaagcagcgggtgcgggaattagaggaggagctc
gaggcggacggagtcggagttagggtttcggaggggaggagggaggagcggggtagtgcg
aaggatgatggacgcggtggcgagagtgatgatggtgtcagagacagggatcatcggagg
gacagggagaaagatagtgtgagggttagggatggtggcggggagcgggacgggaggcgg
gatgcgaggggcaaaccttacgacagggaagatcgtcgggggaatggaggtgggcgagct
agagaaaaggagcgtggcggtagagataaagacgatgtaagtggttggaggaataatgac
aggtatggtggtgaaagtggaagaggaagagggagggatagggaagtcgattacgaagat
ggagacagagttggtcctagctcagggagtgttgtcccaagcagagcgccagtcgtggat
gagccagagctttacggaatatacaaagggagagtgtccaggatcatggattatggttgt
tttgtgcaattgttaggggttagggatcggaaggaggggctagtgcatgtgtataatatt
gcgtctcgacgggttgtcaatgccaaggatgccgtcgaacgggaccaggaagtgtgggtg
aaagttttgtctgtaagtgataagaagattagtcttagtatgcgagacgttgatcagaaa
acaggagaagatttacttcccatgaagcgtacgacaactgaagaagaaaatttgcgtgcc
aatccatccagctctagtttggctccagagatgcgaaagggactgtcgggtataactatt
gtggaagaagaagataacacttcaaaccgtagacccatgaagagaatgagttcgcctgag
cgatgggaggccaaacaacttattgcatcaggtgtgctaggtgttagagactacccaatg
tatgatgatgatggtggaggaatgctgtatcatgatgaaggtgcggaagaagagcttgag
atcgagctcaatgaggatgagccagcttttcttcggggccaaactcgttactcagtcgat
gtttctccagtgaagattgtgaagaaccctgatggttcgttgcaaagagctgccatgaca
cagtctgcgcttgctaaagaacgacgagaattgagggagcagcaacaacggacaatgctc
gattccattccaaaggatctgaacaggccttgggaagatcccatgccagaaactggtgag
agacatctcgcgcaggagctgcgaggagtaggtctgtcagcctatgatatgccggagtgg
aaaaaggatgcgtttggaaaggctcccacttttgggcaaaggtccaaactttcgattcaa
gagcagagacagagcctacccatatataagctgaagaacgagcttatcaaggcggtgcac
gacaaccaagttttagttgtgattggagagacaggttctgggaagactacgcagatgact
cagtacctcgcagaagctggttacacaacccgcggaaagataggttgcactcaaccccgg
cgggttgctgccatgtctgtggcgaagagagtagcggaagagtttggatgtagacttggg
gaggaggtagggtatgcgatccggtttgaggactgtacaggtcccgagacagttatcaaa
tatatgacggacgggatgttgttgagggagatcttgatagacgaaatgtgtgcatcgtat
tcagtcatcatgcttgatgaagctcacgaacgtactatccatacagacgttttgtttggg
cttttgaaggggcttgtgaaacgcagacctgatttacggcttattgtcacttcggctacg
ctggatgcggagaagttttcgagatacttttttgattgccctatcttcaccatacctgga
agaacttatccggtggaaatactatatacgaagcagccggagactgattatttggatgct
gccttgattactgtcatgcagattcatctcacagaacctgaaggtgatgttctccttttc
ttgacagggcaagaagagattgatactgcatgccaaattctctatgagcggatgaagggt
ctgggacctaatgtgccagaactgattattcttccagtttacagtgctctgcctagtgaa
atgcagacaagaatttttgaacccccaccacctggtacaagaaaggttgttgttgcaaca
aatattgctgaggcctctctcacaattgatggaatatactacgttgtggatcctggattt
gcaaagcaaaacgtttataatcctaagttgggtctggattctttggtaattactccaata
tcacaggcttctgccaggcaacgagctgggcgtgcaggaagaactggacctggcaagtgt
tacaggttatatacggaaagcgcatataggaatgagatgttacctacaacagtaccagaa
attcaaagagttaatcttggtttgacaacattgacaatgaaagcaatgggaattaatgat
cttctatcctttgatttcatggatccccctccaccccaagcacttatatctgctatggaa
cagctttacagccttggagcccttgatgaggagggtcttttgaccaagctgggaagaaag
atggcagagtttccactggagccacctctttcaaagatgcttctagccagtgtggacttg
ggttgcagtgacgaaatcttgaccattatttctatggtgcaagctcagaatatcttttac
cgaccacgagagaaacaagcacaggctgatcagaagagagcgaagttttttcaagtagag
ggtgatcatttgacactgctggcagtatatgaagcttggaaagctaagaacttttcaggt
ccctggtgttttgagaattttgtgcagtctcgatcgttgaggagggctcaagatgtgcgg
aagcagcttcttacgattatggataggtacaagttggacgttgtgagtgcaggcaaaaat
tttacaagaatacgaaaggcaatagcagcagggtttttcttccatgcagctcggaaggat
ccccaggagggttaccgtactctggtggagaaccagccagtatatatccatccaagtagt
gctttgtttcagaggcaacctgattgggttatctaccatgagctggtgatgaccacaaag
gagtatatgcgagaagtgactctaatggaccctaaatggttggttgaactggctccacgt
ttcttcaaagttgctgatcccacaaaaatgagtaagaggaagcgacaggagcgaattgaa
cctctctacgatcgataccatgagccaaattcatggcgccttagtaagagacgggcttaa

DBGET integrated database retrieval system