KEGG   Physcomitrella patens subsp. patens: 112285789Help
Entry
112285789         CDS       T01041                                 

Definition
(RefSeq) receptor-like cytosolic serine/threonine-protein kinase RBK1 isoform X1
Organism
ppp  Physcomitrella patens subsp. patens
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Auto_anti-p27
Motif
Other DBs
NCBI-GeneID: 112285789
NCBI-ProteinID: XP_024382709
Position
8
AA seq 680 aa AA seqDB search
MNDENFALENRLSNAGEYDTAIAVKLLAGWVQTGEDCETCMTQLICNRMNQAYCVACSEW
RKTPSNSIDKKVKIPKTKPETTTLLLGDDDTPSFIRVIKASPGQKANIGKKLKDIHMEKS
NLEVNVRSPKESARQRSTLQQNLFCSVPPIVDDDSGPINAALWEECSRYERNFRRNDMKC
EAARGSPRAVLEGPESSGWSESTSRKSLLSLSFTDEVEDDHTGLAQSSQNHCMQSLWRLF
AIQKWQAFPSSSKKKELRISDPVLITSSGRSDEEEPHLGPSDHESVHDLLGVSCNAKRSW
QTFSYEDISLATNNFDSEHLVGKGGYAKVFKGVLKNGQLIAVKKHNRGVTAAEKERDFLT
ELGIVSHVAHTNVAKLLGICIENGLHLVFQFCTLGSLQSLLQYGCGGFTAPNNPPFSWEA
RMKVAVGVAKGLHYLHEQCQRRIIHRDIKASNILLDTDFNPQVGADNSRLLNTVWKASAL
HASVLRFYVSNMVHYSCGIQISDFGLSKWLPERWMHHTVAPIEGTFGYLAPEYFMYGIVD
EKTDVFAYGVLLLELITGRRPVDSKKQNLVAWAKPHLNKCNMKELADLRLDSAFDAGQMQ
RVVLTAGLCVRSSAHWRPSMSQVLQLLTEEGAENESEDLSRLVSRPHDFIPSDTESQDYG
YSDSYESDMQRHRALALNSE
NT seq 2043 nt NT seq  +upstreamnt  +downstreamnt
atgaatgacgaaaattttgctcttgaaaatagactttcgaatgcgggggaatatgacacc
gccatagcggtgaagctactagcgggttgggttcagacgggagaggactgcgagacatgt
atgacgcagctcatctgcaaccggatgaatcaggcctattgtgtagcttgttccgaatgg
aggaaaactccgtctaattccatagacaagaaagtaaaaattccaaaaacgaagccagaa
actactacattgcttttaggagacgatgacacgccgtcgtttattagagtcatcaaggcc
tcaccaggtcagaaggcaaatatcggaaagaaactgaaggatatccatatggaaaagtct
aacctggaagttaatgtgaggagccctaaagagtcggcaagacagagaagcacgctgcag
caaaatctattttgctcggttcctcctattgtagatgacgattctggccccataaatgct
gcactctgggaagagtgttcgagatacgagaggaactttcgaaggaatgatatgaaatgc
gaggctgcaaggggctccccacgagcagttctcgagggcccagaatcaagtgggtggtca
gagtctacttcaaggaaaagtctcttgagcctgtcttttaccgatgaggttgaggacgat
cacactggactggcacaatcaagtcagaaccattgcatgcaaagtctctggagattgttc
gcaattcaaaaatggcaggcttttccctcatcttccaagaaaaaagagctacgcatctcg
gatcccgtgttgataacttcatctggcagaagcgatgaagaggaacctcacctaggaccc
tctgatcacgagtctgtgcacgacttgctcggcgtatcctgtaacgcaaaacgatcctgg
cagacattctcgtacgaggacatttctcttgcgactaacaatttcgactcagagcacctt
gtcggcaaaggtggatacgcgaaggtgttcaaaggagttctgaaaaacggtcagttgatt
gcagtgaagaaacacaaccggggtgtcacagctgcagaaaaggaaagggatttcctgacg
gagttgggcatcgtaagccacgtcgcccataccaatgtagcgaaacttttgggcatctgc
attgaaaacggtcttcatcttgtgttccagttttgtactctcggcagtctccaatcactt
ctccaatatggatgtggtggctttacagcaccaaataacccaccattttcttgggaggcg
aggatgaaagtcgccgtaggagtagccaaaggtttgcactatctgcatgaacagtgtcaa
aggcggatcatacaccgtgatatcaaagcttccaatatactattagacactgattttaat
ccgcaggtcggtgccgacaactcacgtttgctgaatacagtttggaaggcttctgcttta
catgccagcgttcttcgattttatgttagtaacatggtacattactcttgcggcatacag
atttcggatttcggcttgtcaaaatggcttccagaaagatggatgcatcatactgttgca
cctatagaaggaacttttgggtatttggcacccgaatacttcatgtatggaatagtggat
gagaagacggacgttttcgcttacggggtattgctgttggagcttattacaggtcgtcga
cctgtagattctaagaagcagaaccttgttgcatgggcaaagcctcacctaaacaaatgc
aacatgaaggagctcgcagaccttcgtcttgatagtgccttcgatgctggccaaatgcag
cgtgtagtgttaacagcaggcctgtgtgtccgatcgtcagctcattggcgtccttcaatg
agtcaggtactgcaactattgacagaggaaggagctgaaaatgaatccgaggacctgtcc
agactagtatcaagaccccatgatttcataccttctgacaccgaatctcaggactatggc
tactcagatagttacgagagtgacatgcaacggcatagagctctcgcgttaaattccgag
tga

DBGET integrated database retrieval system