KEGG   Physcomitrella patens subsp. patens: 112285965Help
Entry
112285965         CDS       T01041                                 

Definition
(RefSeq) tryptophan 5-hydroxylase 1-like
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
ppp00360  Phenylalanine metabolism
ppp00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ppp00790  Folate biosynthesis
ppp01100  Metabolic pathways
ppp01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ppp00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    112285965
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    112285965
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    112285965
Enzymes [BR:ppp01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     112285965
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Biopterin_H MTTB
Motif
Other DBs
NCBI-GeneID: 112285965
NCBI-ProteinID: XP_024383161
Position
8
AA seq 394 aa AA seqDB search
MAMEVGYLRHSTTITNGLCCNCDPKPRGARRVQTRLPGTLCLVKDTFTSSKAKLKKPSQR
EIFLTSRKRLNQIQAVSTAEKEREADKTSTPPIPSSIHDISNGDHILGFGADLTEDHPGY
HDLEYKRRRSRIADLAKIHKIGEPIPCVDYTSEEIRVWGHVLDTLVDLYPTHACKEYLNC
YELFNFKPNYIPQLQELSEVLERSTGWHIRPVAGLLHPRDFLNGLAFRTFHSTQYVRHGS
NPMYTPEPDICHEVLGHVPILADPEFADLAWAIGQASLGASEKDIWHLTKLYWYTVEFGT
VKEGNEIKAFGAGLLSSFGELKHMRVGTDGFMPEFVELDPFKKMPKMSYKDGYQKRYFLC
ESFADAAAKLRAYSRSILKPEVQSIKFGDTPIRL
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggctatggaagtgggttatcttcggcactcgacaacgatcaccaacggactgtgttgt
aactgtgatccgaagccccgaggagcacgtcgtgtacagactaggctgcctggcaccctg
tgtctcgtcaaggatacctttacctctagcaaagctaaactaaaaaagccgtctcagaga
gaaatctttctaacaagtaggaagaggctgaatcagatacaagctgtttcaacggctgaa
aaggagagagaggcagacaaaacatccactccacctattcccagtagcatccacgatatt
tcaaatggagaccacattcttggcttcggagccgatttgaccgaagatcatcctggctac
catgatcttgaatataagaggaggcgtagtcgtattgctgaccttgcgaagatacataaa
ataggtgaacccattccttgcgtggactacacatcggaagagattcgtgtgtggggtcat
gtgttagatactctagtggacctctacccaactcatgcttgtaaggaatacctgaattgc
tacgagctgtttaacttcaagccaaactatattccacagctgcaagaactttcggaggtc
ctggaacggagcacaggatggcacatccgcccagtagctggactcctccaccctcgtgac
ttcctaaacggtctagccttccgcactttccattcaacccagtatgttcggcatggcagc
aatcccatgtacacccccgagccagacatttgtcacgaggttttaggccacgtccccatt
ctggctgatccggagtttgctgacttagcttgggccattggccaagcttctctgggtgct
tcagagaaggatatctggcaccttacgaagctctactggtacactgtggagtttggcaca
gtaaaggaaggtaacgagattaaagcgttcggtgcaggccttctgtctagttttggggag
ctgaagcacatgcgggtggggacggatggattcatgcctgagttcgtggagcttgacccg
tttaagaagatgcccaagatgagctacaaagacgggtaccagaagaggtattttctatgc
gagagctttgcagatgcagcggcaaagcttagggcgtattccagaagcattctgaagcct
gaggtgcagtccatcaagtttggagatacgccaatccggctctaa

DBGET integrated database retrieval system