KEGG   Physcomitrella patens subsp. patens: 112286866Help
Entry
112286866         CDS       T01041                                 

Definition
(RefSeq) pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH10-like isoform X1
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
ppp03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:ppp00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    112286866
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:ppp03041]
    112286866
Enzymes [BR:ppp01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     112286866
Spliceosome [BR:ppp03041]
 Complex C
  Other components
   Step II factors
    112286866
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HA2 OB_NTP_bind Helicase_C DEAD AAA_22 AAA_19 AAA_30 T2SSE ABC_tran FtsK_SpoIIIE DAP3 DUF1539 Lsr2
Motif
Other DBs
NCBI-GeneID: 112286866
NCBI-ProteinID: XP_024384968
Position
9
AA seq 773 aa AA seqDB search
MPSMAPLSSGNKNGDGNGNVPGRGNGVPFGGHWGPPESTSATPSAANEAVGKRKATTLLP
QTRVTKRQALLNQRRALPIASVESELVNHVKKNETLVVIGETGSGKTTQLPQFLHSAGFC
KGGMMVAITQPRRVAAITVATRVAEEMGVEVGQEVGYSIRFEDCTSPSTQLKYMTDGMLL
REALLDPLLSRYSLVVIDEAHERTIHTDVLFGLLKGVQKRRQAASTATKSSKKKAATTGV
ALKDLQNLLTTSKTPLEKKNSALKLVVMSATLDTKGFCEYFNGAEAVYVQGRQFPVEIFY
TFTPEADYLDAALLTTFQIHLEEIPGDILLFLTGQEEIESMERLLKERASHLSPKVPKLL
VVPIYAALPSEQQMRVFQPAPDGTRKVILATNIAETSLTIPGIRYVIDPGLVKARAYNPR
TGVESLEVVPVSKAQARQRSGRAGRERPGKCFRLYTEDLYRKLEDSTVPEIKRCNLANVV
LQLKAFGIDDVLGFDFMDKPSRIAIVKSLEHLYSLGALTDEGKLSDPIGTRMARFPLEPM
YAKAMLISCEMGCSEEMLATVSMMSVDSVFYAPRDKLQEANNARNRFISADGDHITLINV
LRHYIQEAEEAGAGAGAGEAEDTSSNSNSNENKKVFKRIRSWCTANFINARSLKRAVDIQ
KQIRGYVEGMGLTIISCGDDMLSFRRCLAASFFLNAARRQLDGTYRALASGQSVAIHPSS
VLFGQKPDCVVFNELVRTNRSYIRNITRVDSLWLPELAPHYYAAQALNTPCQS
NT seq 2322 nt NT seq  +upstreamnt  +downstreamnt
atgccatccatggcgccgctttcgagtggaaacaagaatggggatgggaatggaaatgtt
cccggcaggggaaatggggttccttttggtggtcattggggtcctcctgagtccacatcg
gccactccatctgcggctaatgaggcggttggcaagcgaaaggcaactacacttcttcca
cagactagagttaccaaacggcaagcacttttgaatcaaaggcgtgctctgccaatcgca
tcagtggaatccgagctcgttaatcatgtcaagaaaaacgagactctggtcgtaattggt
gagacaggaagcgggaaaactacacagttacctcaatttttgcattctgcggggttttgc
aagggtggcatgatggttgccatcactcagccacggcgtgttgcagctataactgtggca
acccgtgtagcagaggagatgggtgtagaggttgggcaggaggttggttattcgatcaga
tttgaagattgcacatctccttcaacgcaacttaagtacatgactgatggtatgctactg
agggaagcactactggaccctctactatcgagatattcacttgtagtgatagatgaagct
cacgaaaggactatccacacagatgtgttgtttggtctactcaagggagtccaaaagaga
aggcaagcagcaagtacagctacaaaatcctccaagaagaaagcagcgacaactggagtt
gcactaaaagatctacagaatttgctaactactagtaaaacccctctcgaaaaaaaaaat
agtgctttgaagttagtggtaatgtctgcaaccttggacacgaagggtttctgtgaatac
ttcaatggagcagaggcggtttatgtgcaaggccgtcagtttcctgtagagatattctat
acctttacgccagaagctgattatctcgatgctgctctccttactacatttcagattcac
ttggaggaaatcccaggagatattttactcttcttgacaggacaagaggagattgaatca
atggagcggcttttgaaggaacgtgcttctcatttgtctccaaaagttcctaaactattg
gttgtccctatatatgctgctcttcccagtgagcaacaaatgcgtgtattccagcctgct
cctgacggaacacgaaaggtaatattggcaaccaatattgcagagacatcacttaccatt
cctggcattcggtatgtgatagacccaggcctagtaaaggcaagagcgtacaacccgcgt
accggggtggagtcattggaggttgtgccagtatcaaaagctcaggcccgacaacggagt
ggtcgtgcagggcgagaaaggccaggaaagtgttttcggctgtacacagaagatttatat
agaaagttggaagactcaactgtacctgaaatcaaacgctgcaatcttgcaaacgttgtt
ctacaactgaaggcttttggtattgacgatgtgcttggattcgacttcatggacaagcct
tccaggatagctattgtaaagtcattggagcatctctatagtctcggagctctgaccgat
gaaggcaagctttctgatccaattggtacgaggatggctcggtttcctctggagcccatg
tatgctaaggctatgctcatctcctgtgagatgggatgttctgaggagatgcttgctaca
gtgtccatgatgtcggtcgattccgttttttatgccccacgtgataaacttcaggaggca
aacaatgctagaaatcgattcataagtgcggatggggatcacatcaccttaatcaatgtc
ctgcgtcactacatccaagaagcggaagaggctggggcaggggcaggggcaggtgaagca
gaagacactagcagcaattcaaattctaacgaaaacaaaaaggttttcaagcgtatccgt
agttggtgtaccgcaaacttcattaatgctcggtcattgaaacgagcagttgacatccag
aagcaaatacgaggttatgtggaaggcatgggcttgacaatcatatcttgtggagatgat
atgctttcgtttcgccgttgtcttgctgcttctttcttccttaatgctgctcgacgccaa
ttggatggaacctatagggctttggcaagtggtcaatcagtggctatccatccatcatca
gtactatttggacagaagcccgactgtgtggtgtttaacgaactcgtgcgaacaaatcgt
tcgtacatacgcaatatcactcgagttgattcactgtggctgccagagctcgctcctcat
tactacgcagcacaagcgttgaacacaccatgtcaatcctag

DBGET integrated database retrieval system