KEGG   Physcomitrella patens subsp. patens: 112287071Help
Entry
112287071         CDS       T01041                                 

Definition
(RefSeq) receptor-like protein kinase THESEUS 1
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
ppp  Physcomitrella patens subsp. patens
Brite
KEGG Orthology (KO) [BR:ppp00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ppp01001]
    112287071
Enzymes [BR:ppp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     112287071
Protein kinases [BR:ppp01001]
 Serine/threonine kinases: TKL group
  IRAK family
   112287071
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase APH ABC1 Syndecan Adeno_E3_CR2 Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 112287071
NCBI-ProteinID: XP_024385474
Position
9
AA seq 515 aa AA seqDB search
MVPMINTYPKINVRIAPDRSNPNAKNVLLNGLEIFKVNNANSSLAGPNRIIEPNTTSGGT
QTTNSSSSSNLGAIIGASIGGVAAVLAAAALVIFCCYKKKTKSDKPGAPSHWLPLPLHGS
STDHSKVSTSSAKSGKSGAGSYVSSVPSNLGRYFSFAELQEATNNFDESLVLGVGGFGKV
YKGETDDGSKVAVKRGNPRSEQGLNEFQTEIELLSKLRHRHLVSLIGYCEEHGEMILVYD
YMANGPLRGHLYGTDEAPLSWKQRLEICIGAARGLHYLHTGAAQGIIHRDVKTTNILLDE
NFVAKVADFGLSKIGPANEVTHVSTAVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLMEV
LSARPAINPALPREEVNLADWAIKYYKAGMLDQIVDEKLRDTINPDSLKTFGDTVEKCLQ
EQGIDRPSMGDVLWNLEYALQLHEASVKGAMSSLDQENFSTDSDNSHMISVPLVVPNLFD
DSLTMHIERRMLEETSSEDQSASATFSQLIDPQGR
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atggtgcccatgatcaatacctatccgaaaataaatgttaggatcgcccctgaccgtagt
aatccaaatgccaagaatgttctgttgaatggtctggagattttcaaggttaacaacgcg
aactccagtcttgcaggtcccaaccgtattatagagccaaacactacctctggtggtaca
caaactacaaattcaagctcgagctccaacttaggtgccatcatcggtgcgtccatcgga
ggcgtagccgccgttcttgcggcggctgcgttggtcatcttttgttgctacaagaagaag
accaagtctgacaagcctggcgcaccaagtcattggctcccgctgcctctgcacggcagc
agtactgaccacagcaaagtgtcgactagttcggcgaagagtgggaagagtggtgcagga
agttatgtttcttcagttccatccaacctgggcaggtacttcagcttcgcggagctccaa
gaagccacgaacaacttcgacgagtctttggttttgggagtgggtggattcggcaaggtg
tacaagggtgagactgatgatgggtcgaaagtggcggtgaagcggggaaaccccaggtca
gagcagggtctaaacgagttccaaaccgagatagagcttctgtcgaaactccgacatcgg
cacctggtgtcactgatagggtactgcgaggaacacggtgagatgattcttgtatatgat
tacatggccaacggtccgctcaggggtcacctgtatggaacagacgaggctcctctgtcg
tggaagcagaggctggagatttgtatcggtgcagcacgaggattgcattacctacacacc
ggcgcggcgcaagggatcattcacagggatgtgaaaaccacgaacatccttctggacgag
aacttcgttgccaaggtggctgacttcgggttgtcgaaaatcgggcccgcgaatgaagtc
acgcacgtgagcacagccgtgaagggcagcttcgggtacctggatcccgagtatttccgc
agacagcagctgacggagaagtcagacgtgtactccttcggtgtcgttctcatggaggtg
ctgagtgcacgaccggcaatcaatccggcccttcctcgagaggaggtgaacttggcagac
tgggcaatcaagtactacaaagctggcatgctggatcagatcgtggatgagaagctgcgg
gatacaatcaaccccgactcgttgaaaacattcggcgacaccgtcgagaaatgtctgcag
gagcaaggtatcgatcgaccttccatgggtgacgtcctgtggaatttggagtacgccttg
caactacatgaagcatctgtgaagggcgccatgtccagccttgatcaagaaaacttcagc
accgactctgataacagccacatgatctccgtgccgctggttgtgcccaaccttttcgat
gactcgttgacgatgcacatagaacgaagaatgctggaggagacctcctctgaagaccaa
tcggcgagcgccacattctctcagttaatcgaccctcaaggtaggtaa

DBGET integrated database retrieval system