KEGG   Physcomitrella patens subsp. patens: 112287926Help
Entry
112287926         CDS       T01041                                 

Definition
(RefSeq) uncharacterized protein LOC112287926 isoform X1
  KO
K06210  nicotinamide mononucleotide adenylyltransferase [EC:2.7.7.1 2.7.7.18]
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
ppp00760  Nicotinate and nicotinamide metabolism
ppp01100  Metabolic pathways
Module
ppp_M00115  NAD biosynthesis, aspartate => NAD
Brite
KEGG Orthology (KO) [BR:ppp00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    112287926
Enzymes [BR:ppp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.1  nicotinamide-nucleotide adenylyltransferase
     112287926
    2.7.7.18  nicotinate-nucleotide adenylyltransferase
     112287926
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CTP_transf_like Myb_DNA-bind_4 Myb_DNA-bind_6
Motif
Other DBs
NCBI-GeneID: 112287926
NCBI-ProteinID: XP_024387340
Position
10
AA seq 606 aa AA seqDB search
MEQGAPPSALIEGALSTATNLDQADHSFVNQFGRDSFSGGKRQSSYTNSGYSNRQGFVRD
SQIAFTSFIEKGAFPHHEFPRDTVVKDSGGTTFPESGPAIKRQKRPEWWQESEGVERTPE
PFKHVHSGVNANATPPTVPAFGSPVIPFRDTQSRMGSSLVGIEGNLVEGELGASSGEGAG
VGEDEDGGDGDGKERSDKEGFARKKRAEMWQDAEMDALVKAFREVNFKLAAAGKKGKQVF
KSANDKWKEVRTLLLGAGVDRQPKEIERKWSNLSTAFKQIADWNKKVGRPSYWELDEVLK
KEKTKAKELPATFRVQLFEAMTEIMGDRQGSRSRSPAQGTPGHVPVPGLPRPPSAPGVVE
MPLPMEKLVVHANLLDGGNHKKSRVVLLAPGSFNPPTYMHLRMFELGRDALRAEGYQVLG
GYMSPVNDQYHKKGLAPAEHRIRMCQLAVADSPIIMVDPWEAKQSSSQRTITVLARIETA
INSNNLVSDEKARVMLLCGTDLLESLITPGVWIPDQVRALLQDYGIVCINQSGKDARRLV
FEDDVLYSNRRQILVVDENIKNSISATAIRRNLARGLSVRYLTPDPVISHIKMHSLYMNV
HTPQQF
NT seq 1821 nt NT seq  +upstreamnt  +downstreamnt
atggaacagggggctcctccctccgcgttaatcgaaggggccctctctaccgctactaat
ttagaccaagcagaccacagttttgtcaaccaatttgggcgggacagcttctctggaggg
aaaagacaatcatcttatacaaattctggttactcaaaccgacaaggttttgtgagggat
tcccagattgcgttcacgtcgtttatagagaagggtgcctttcctcaccatgaatttcct
cgtgacactgtggtcaaggacagcgggggcaccacttttcccgagtctggtccagccatc
aagagacaaaagcgtccggaatggtggcaggagtctgaaggggtcgaaaggactccggag
ccttttaaacatgttcattctggtgtaaatgctaatgcgactcctcctacagtgcctgca
tttgggagccccgtaattcctttcagggacactcagagtcgaatgggttctagtctggtt
gggatcgagggcaatttagttgaaggtgaacttggggctagtagtggcgaaggagcagga
gttggtgaggatgaggatggaggagatggtgacggaaaggaaaggtcggacaaggaaggg
tttgctaggaagaaaagagcagagatgtggcaggatgctgaaatggacgctctcgtgaaa
gccttccgggaggttaattttaagctcgcagcagctggaaagaaaggaaaacaggtgttt
aagtcagccaatgataagtggaaggaggttagaacgcttcttctgggcgctggagtggat
agacaacctaaagaaatcgaacgtaaatggtcgaatctctctaccgcatttaagcagatt
gctgattggaataaaaaggtggggcgtcctagttactgggaattagatgaggttctgaaa
aaagagaagaccaaagcaaaggagctgccggctacatttagggtgcagcttttcgaagct
atgactgagattatgggtgatcgccagggttctcgtagccgatcacctgcacaagggacc
cctgggcacgtacctgtacctgggcttcctcgcccaccctctgctccaggagtagttgag
atgccactgcctatggagaagctcgttgttcatgccaatctcttagatggtggaaatcac
aaaaagtcgcgcgttgttctactagccccaggcagctttaatccaccaacatatatgcat
cttcgcatgttcgagttgggaagggatgctctcagagcagagggttatcaagtattggga
gggtacatgtctcctgttaatgaccaataccacaagaagggtcttgctcccgcagagcac
cgtattaggatgtgccagttagcagttgctgattcacctattataatggtagacccctgg
gaggctaaacagagttcctcccagagaacgatcactgtgctagcacggattgaaacggcg
attaattccaataacttagtctctgatgaaaaagcaagagtcatgctgctttgtggaact
gacctgcttgagtcccttataactccaggcgtgtggataccagatcaggtgcgagctcta
ttacaagattatggaattgtgtgcataaatcaaagtgggaaggatgcacgtcgccttgtg
tttgaagacgacgtgttgtatagtaaccgaagacagattctggttgtggatgagaacatt
aagaacagtataagtgcgacagcaatcaggcgaaatttggcaaggggattatcggtgagg
tatttgacccccgatccagtgatcagtcatatcaagatgcacagtctgtacatgaatgtt
catacccctcagcaattctaa

DBGET integrated database retrieval system