KEGG   Physcomitrella patens subsp. patens: 112288308Help
Entry
112288308         CDS       T01041                                 

Definition
(RefSeq) serine/threonine-protein kinase GRIK1-like isoform X1
  KO
K00908  calcium/calmodulin-dependent protein kinase kinase 1 [EC:2.7.11.17]
Organism
ppp  Physcomitrella patens subsp. patens
Brite
KEGG Orthology (KO) [BR:ppp00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ppp01001]
    112288308
Enzymes [BR:ppp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     112288308
Protein kinases [BR:ppp01001]
 Serine/threonine kinases: Other
  CAMKK family
   112288308
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Kdo
Motif
Other DBs
NCBI-GeneID: 112288308
NCBI-ProteinID: XP_024388153
Position
11
AA seq 562 aa AA seqDB search
MSAIPTEQTRPPEADARDFVEGETQRPQLLIAVQERILQDPILAGHFAGLPTPGVPLLIG
DPFNALSSPHQLRTSHRLVRAVDAFGNKYLNQYIVIKLLGCGRYGKVKLCLNAFDGKLFA
VKVVDRKRLRDRRFLNEDGDSIMLQEYVHEIATLKKLHHPNIVALHEVIDDVQQRKVYLV
LEYVEGGPVMEDNRWIAFPEELAQKYFRDICCGLDYLHYHKVLHRDLKPENLLQTADGRI
KISDFGVSQVFETKSRSFLLPKNISIQQACKRHFSTDALSSTAGTPAFLAPEACTKSSFE
GRPVDVWALGVCLYVFVFGTLPFSGKTIPDIYHAIQHKQLSFHPSIVISKELKDLLKLIL
VKDPKIRISLPSIMEHPWLTLFGLQLLIPLSKSVHGAATMDFSKNDLKSAHTTSTSGLNP
LSKVGEQEKRFQAGEYAKGQGKQGNKSCFMNCSKCEILVDADPELGGEMDECVVIKREPG
KFGAWKMAAVINQNLTDSPPCSGTSLRSRVPIRGKAPTTATVPNELKDVLDAMPQPQDEK
VLSIKKKSSEVRCGQFRWCTTM
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcgattcccacagagcaaacgcgaccccctgaggccgacgcgcgtgatttcgtt
gagggggagacacagaggccacagttgttgatcgctgtgcaggagcgcattctgcaggac
cccatcttggccgggcactttgctggactccctacccctggcgtaccgctgctcattggt
gaccccttcaatgcgttgtccagcccgcatcagctacgcacttcccaccgtttggttcga
gcggtggatgcgtttgggaacaaatatttgaaccagtatatcgttatcaagcttcttggg
tgtggacgctacggaaaggttaagctctgcctcaatgcatttgatggtaaattatttgct
gttaaggtcgttgatcgcaaacgactcagagatcgcagattcttgaacgaggacggtgac
agcatcatgctccaggagtatgtgcacgaaattgcgacattgaaaaagcttcatcaccca
aatatcgtggcgttgcatgaggtaatagacgacgttcagcagaggaaggtgtacctagtg
ctagaatacgtggaaggtggacctgttatggaagacaacaggtggattgcttttccagag
gaactggctcagaagtattttcgtgatatttgctgcggattagattaccttcattaccat
aaggtcttgcacagagatttgaagcctgaaaatttgctacagacagctgatggacgcatc
aaaattagcgattttggagtctctcaagtatttgagacgaaaagccgtagttttcttctc
ccgaaaaatatttcgatccaacaagcatgtaaacggcacttctcgacggatgcattaagc
tccaccgctggcactcctgcttttcttgctcctgaggcgtgcaccaagagttcttttgag
gggcgcccagttgacgtatgggcacttggggtctgcttgtatgttttcgtcttcggtact
cttccattctcggggaagaccatcccggacatctaccatgccattcagcacaagcagctt
tcttttcacccatccattgtaatctctaaggagctcaaggatctgctgaaacttatattg
gtcaaagatcccaagatacgcatctctctgccaagcatcatggaacacccatggttaacg
ttatttggactgcaattgttaatccctctctcgaaaagcgtgcacggagcagcaactatg
gatttttcaaaaaatgatcttaagtcggctcacaccaccagtacttcaggtttaaaccct
ctttccaaggtgggagagcaggaaaagaggtttcaggcaggtgaatacgccaagggacag
ggaaaacaaggaaataaatcatgtttcatgaattgtagcaaatgtgagattttggtcgac
gctgatcctgaacttggtggcgagatggatgaatgtgttgtaataaaaagagaacctggg
aaatttggtgcatggaagatggctgctgttatcaaccaaaatctgacggactcgccgccc
tgtagtggaacttcgcttcgatcacgggtacccattcgagggaaggctccaacaactgct
acagtaccaaacgaattgaaggacgtcttggacgccatgccccagcctcaggatgagaaa
gtcctctcaatcaagaaaaaatccagcgaagtccggtgtggtcaattcaggtggtgtaca
acgatgtga

DBGET integrated database retrieval system