KEGG   Physcomitrella patens subsp. patens: 112288739Help
Entry
112288739         CDS       T01041                                 

Definition
(RefSeq) probable nucleolar protein 5-2
  KO
K14565  nucleolar protein 58
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
ppp03008  Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:ppp00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    112288739
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:ppp03009]
    112288739
Ribosome biogenesis [BR:ppp03009]
 Eukaryotic type
  Sno RNPs
   Box C/D snoRNPs
    112288739
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Nop NOP5NT DUF936
Motif
Other DBs
NCBI-GeneID: 112288739
NCBI-ProteinID: XP_024389034
Position
11
AA seq 592 aa AA seqDB search
MLALFETPAGFALFKVLNEGKLDASEELYKEFETADLARKMVKLKAFEKFENTTDALNAA
SHLVESKLPKGLRKFLKKECQGETLAIADSKLGKAISDKLEINCVNNAAVAELMRGLRSQ
LSELISGLAGHDMAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAIGLLDDLDKELNTYAMR
VREWYGWHFPELAKIVQDNVQYAKSVKLMGSRTNAADLDFSGILQEEVESEMKEAAVISM
GTEVSDHDMLNIKSLCDQVIALSEYRGQLFDYLRSRMNAIAPNLTVMVGELVGARLIAHA
GSLINLAKHPASTVQILGAEKALFRALKTKHETPKYGLIYHASLIGQAAPKFKGKISRVL
AAKSALSIRMDALGEGSEASIGIESRAKVEARLRQLEGRALGKTPVSASKGKPNIQAYEK
DRKSGTPGLLSAAKVYNPSADVTMDEPTDATPAKKKKIKEAAEEPAAEPAAEDTLPKKKK
KSKEAAAEAEPEPTTDATSPKKKKKKSKQAAEEAAAEPTTEATPPPKKKKSKDAVTPTVA
VAVAVTPELTKSGKKRKAETEAAAGAAVEAAVEAVTGVEKKKKKKKSKEESA
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
atgttggcgctcttcgagacgcccgcggggttcgccctgttcaaggttttgaatgagggt
aaactcgatgcctccgaggaattgtacaaggagtttgagactgcggacctcgcccgtaag
atggtgaagttgaaagcctttgaaaaattcgagaataccacagatgccctgaatgctgcg
tcacaccttgtggaaagcaagttgccaaagggtctgcgcaagttccttaagaaagaatgc
caaggggagactctagctatagctgactcgaagcttggaaaagctattagtgacaagctg
gaaatcaactgtgttaacaatgcggcagtggcagagctgatgaggggtctaagatcacaa
ttgtcggaactaatttctggtcttgctggtcatgatatggctcccatgagtctgggactg
tctcacagtttatcgcgatacaaacttaaattcagccctgacaaggtggacaccatgatc
gtgcaagccattggactcttggacgatttggacaaggagctaaatacttatgctatgaga
gtgcgtgaatggtatggttggcattttccagagcttgctaagatcgttcaagataatgtt
caatacgctaagtcagtgaagctgatgggcagtcgcactaacgccgcagacctggatttc
tctgggatattgcaagaggaagtagagtctgaaatgaaagaagctgcagtcatttccatg
ggtacggaagttagtgaccacgatatgttgaacatcaagtccttgtgcgaccaagtcatt
gctctctcagagtaccgaggccaactttttgactacttgaggagtcgtatgaatgctatt
gcgcctaatcttactgtcatggttggggagttagtaggtgctaggttaattgcccatgct
ggaagtctcattaacttggcaaaacacccggcaagcactgttcaaattttgggtgctgaa
aaggcactttttagggcattgaagaccaaacatgaaactccgaaatatgggcttatttat
cacgcctctttgataggacaagcggcacctaaattcaagggtaaaatttctcgagtcctt
gctgcaaagtcggcgctgtcgatccgtatggatgctctgggagagggctcggaagctagc
attggtattgaaagccgcgctaaggttgaagcaaggttaaggcaacttgaaggtagagct
cttggaaaaactcctgtctctgcatccaagggcaagcccaatattcaggcttatgaaaaa
gataggaaatctggaactcctggattgctttctgccgccaaggtttacaatccctccgct
gatgttactatggatgaacctactgatgccacccccgctaagaagaaaaagatcaaggag
gctgcagaggagccagctgctgaaccagcagccgaagacactttaccgaagaagaaaaag
aaatctaaggaagctgcagcagaggcagaacctgaaccaactacggatgccacttcaccc
aagaagaagaagaagaaatccaagcaagccgcagaagaggcagctgctgaacctaccaca
gaggccactcctccaccaaagaagaagaaatcaaaggatgctgtcacacctaccgttgcg
gttgccgtggctgtcacaccagagctcaccaagtctgggaagaagaggaaagctgagact
gaagctgccgccggggctgcagtagaggccgcagtggaggcagtcactggagtagagaag
aagaagaaaaagaaaaagagcaaggaagaatctgcctaa

DBGET integrated database retrieval system