KEGG   Physcomitrella patens subsp. patens: 112288867Help
Entry
112288867         CDS       T01041                                 

Definition
(RefSeq) heat shock cognate 70 kDa protein-like
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
ppp03040  Spliceosome
ppp04141  Protein processing in endoplasmic reticulum
ppp04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:ppp00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    112288867
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    112288867
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112288867
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ppp01009]
    112288867
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:ppp03041]
    112288867
   03009 Ribosome biogenesis [BR:ppp03009]
    112288867
   03110 Chaperones and folding catalysts [BR:ppp03110]
    112288867
   04131 Membrane trafficking [BR:ppp04131]
    112288867
   03051 Proteasome [BR:ppp03051]
    112288867
   03029 Mitochondrial biogenesis [BR:ppp03029]
    112288867
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ppp04147]
    112288867
Protein phosphatases and associated proteins [BR:ppp01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     112288867
Spliceosome [BR:ppp03041]
 Complex B
  Other components
   Prp19 complex
    112288867
 Complex C
   Prp19-CDC5 complex
    112288867
Ribosome biogenesis [BR:ppp03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    112288867
Chaperones and folding catalysts [BR:ppp03110]
 Heat shock proteins
  HSP70 / DNAK
   112288867
Membrane trafficking [BR:ppp04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    112288867
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    112288867
Proteasome [BR:ppp03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    112288867
Mitochondrial biogenesis [BR:ppp03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    112288867
Exosome [BR:ppp04147]
 Exosomal proteins
  Proteins found in most exosomes
   112288867
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C Hydantoinase_A DDR Zincin_2
Motif
Other DBs
NCBI-GeneID: 112288867
NCBI-ProteinID: XP_024389316
Position
11
AA seq 648 aa AA seqDB search
MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN
QVAMNPINTVFDAKRLIGRRFSDASVQSDMKLWPFKITPGPGEKPMISVQYKGEEKTFAA
EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVLRIINEP
TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD
NRMVNHFVQEFKRKYKKDIGSNPRALRRLRTAAERAKRTLSSTAQTTIEIDSLYEGVDFY
STITRARFEELNMDMFRKCMEPVEKCLRDAKMDKSSIHDVVLVGGSTRIPKVQQLLQDFF
NGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLI
ARNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERARTRDNNLLGKFELSGIPPAPRGVPQI
TVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIEKMVQEAEKYKSEDEDHKK
KIDSKNGLENYAYNMRNTIKDEKIANNLDAADKKKIEDAVDAAIHWLDQNQLAESDEFDD
KLKELEGICNPIIARMYQGGAGGERPVPPYGGSDSPPSGAGPKIEEVD
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
atggctggtaagggcgagggtcctgccatcggcatcgaccttggtactacttacagttgc
gtcggagtgtggcaacatgatcgtgtcgagatcattgccaacgaccagggtaacagaacc
accccgagctatgtggctttcactgactctgagcgtctcatcggtgatgctgctaagaat
caggtggccatgaaccccatcaacactgtattcgatgctaagaggttaattggaaggcgt
tttagtgacgcttctgtccagagtgatatgaagttgtggccattcaagatcacccccggg
ccgggagagaagcccatgatcagtgtgcaatacaagggtgaggagaagactttcgccgcc
gaggagatatcttccatggtgcttatcaaaatgaaggagattgctgaggcatatctcggg
tccacggtaaagaacgctgtggtgactgttccagcttacttcaatgattctcagaggcag
gcgacaaaggatgcaggagtcatcgctggtttgaatgtgctgcgtattataaacgagcca
actgctgctgctatcgcgtatggcttggacaagaaggcgacttctgtgggcgagaagaac
gtgttgattttcgacttagggggaggtacctttgatgtatctttgttgaccattgaggag
ggtatcttcgaggtgaaggccaccgctggagatactcacttaggaggagaggatttcgac
aacagaatggtgaaccacttcgtgcaggagtttaagcgcaagtacaagaaggacattggt
agcaatcctcgtgcgctgagaaggctgaggactgctgccgagagggcgaagaggaccctc
tcatcgactgcacaaaccacaattgaaatcgattcgttgtacgagggtgttgacttttac
tctaccataactcgtgctagattcgaggagttaaacatggatatgtttaggaagtgtatg
gagccagtggagaagtgtctaagggacgctaagatggacaagtcatccatccacgatgtc
gtgttggtcggtggatccactcgcattcctaaggtgcagcagttgctccaggatttcttc
aacggcaaggagctgtgcaagtccatcaatcctgatgaggctgttgcttacggtgccgct
gtccaggctgccatcttgtccggagaaggtaatgagaaggtgcaggaccttctgctattg
gatgttactcccttgtctttaggacttgagaccgcaggaggagtaatgacagtgctaatt
gcaagaaacacaaccatccccaccaagaaggaacaggtattttcaacatattcggacaac
caaccgggagtgttgatccaggtgtacgagggtgagagagccaggaccagggacaacaac
ttgctcggaaagttcgagctctctggcattccccctgcccctcgcggtgtaccgcagatt
actgtgtgtttcgacatcgacgccaacggtatcttgaacgtatctgctgaagacaagacc
actggacagaaaaataagataacaatcactaacgacaagggccgcctgtccaaggacgag
atcgaaaagatggtgcaggaggctgagaagtacaaatccgaggatgaggatcataagaaa
aagattgattcgaagaatgggcttgaaaactatgcttataacatgaggaacaccatcaag
gacgaaaagattgcaaataacttggacgctgccgacaagaagaaaattgaggacgctgtc
gatgctgctattcattggttggaccagaaccaattagcggagagcgacgagttcgacgat
aagttgaaggaattggaggggatttgcaaccccattattgcgaggatgtaccaaggaggt
gcaggaggtgagcggcctgtaccaccgtacggaggaagtgattctcctccatccggtgct
ggccccaagatcgaggaggtcgactaa

DBGET integrated database retrieval system