KEGG   Physcomitrella patens subsp. patens: 112291764Help
Entry
112291764         CDS       T01041                                 

Definition
(RefSeq) glucose-6-phosphate 1-dehydrogenase 2, chloroplastic-like
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
ppp00030  Pentose phosphate pathway
ppp00480  Glutathione metabolism
ppp01100  Metabolic pathways
ppp01110  Biosynthesis of secondary metabolites
ppp01200  Carbon metabolism
Module
ppp_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
ppp_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:ppp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    112291764
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    112291764
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ppp04147]
    112291764
Enzymes [BR:ppp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     112291764
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     112291764
Exosome [BR:ppp04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   112291764
  Exosomal proteins of colorectal cancer cells
   112291764
  Exosomal proteins of bladder cancer cells
   112291764
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G6PD_C G6PD_N VWA_3_C
Motif
Other DBs
NCBI-GeneID: 112291764
NCBI-ProteinID: XP_024395397
Position
14
AA seq 589 aa AA seqDB search
MAALKQAASLWGVRGGTKLGSVSSVSRSASLMSPTSLSATARSYRMVAVRAAVSGGKSVK
LAQESSNDETIKSIERVITQDESPKPGFLNGSAVSTETTVSITVVGASGDLAKKKIFPAL
FALYYENCLPKHFTIYGFARSKMTDEQLRELISGTLTCRIDRRENCGDKQEEFLKRCFYH
SGQYSSEDSFSDLSKKLQKEEGERVANRLFYLSIPPDIFVDVARSSSCAASSKNGWTRVI
VEKPFGRDAESSSELTKGLKKHLKEDQIYRIDHYLGKELVENLSVLRFSNLVFEPLWSRQ
YIRNVQFIFSEDFGTEGRGGYFDNYGIIRDIMQNHLLQILALFAMEPPVSLDAEDIRNEK
VKVLRSMRKLDIDNVVVGQYKGHTRGGVKYPAYIDDKTVPNNSITPTFAAAALFIDNARW
DGVPFLMKAGKALHKRGAEIRVQFRHVPGNLYKRSFGTDLDKATNELVIRVQPDEAIYLK
INNKVPGLGMRLDRSNLNLHYAARYNKEIPDAYERLILDAVEGERRLFIRSDELDAAWAL
FTPLLKELEKRKVAPELYPYGSRGPVGAHYLAAKYNVRWGDNSYEPTEN
NT seq 1770 nt NT seq  +upstreamnt  +downstreamnt
atggcggctctcaagcaagcggccagtctatggggagttcgaggcggcaccaagttgggt
tcggtgagctcggtgtcgaggagcgcctcgttaatgtcgcccacttcgttgagtgcgact
gcgaggagttaccgaatggttgctgtgcgtgctgcagtctctggtggaaagtctgtgaag
cttgcgcaagagtcgtcaaacgatgagacaatcaaaagtattgagcgtgtgatcacccag
gacgagtctcccaaacctggtttcctgaatgggagtgcagtttcgactgagaccacggtt
tctatcactgtcgtgggcgcttctggagacttggcgaagaaaaaaatcttcccagctttg
ttcgcactctactacgaaaattgcttgcctaagcattttactatatatggattcgcaaga
agcaaaatgacggatgaacagttgcgagaattgatctcgggaacattaacatgccgaatt
gatcgaagagaaaactgtggtgacaaacaagaggagtttctgaagcgctgtttctatcac
tctgggcagtacagctctgaggacagtttcagcgatctttctaaaaaacttcaaaaagaa
gagggtgagagggtggcgaaccgactattttacctctctatcccgcctgatatctttgtt
gacgtggcccggtcgtcaagttgtgccgcatcgtcgaaaaatggttggactcgtgtcatc
gtggagaagccattcggtcgggacgcggaatcttcatcagagcttacaaagggcttgaag
aagcatctgaaagaagaccaaatttatcgtatcgatcattacttgggaaaggagcttgtg
gagaatctgtcagtgttacggttctccaaccttgtctttgagcctttgtggtcacgccaa
tacatccgcaacgtgcaatttatattttctgaggactttgggacagaaggacgtggaggg
tactttgacaattacggtattattcgtgatattatgcaaaatcatcttttgcaaattctg
gctttattcgctatggagccccctgttagtctggatgctgaagatatacgaaatgagaag
gtgaaggttcttagatccatgagaaaattagacattgataatgtggtagtaggtcaatac
aaggggcacactcgaggtggcgtgaagtatcctgcctacatagatgataaaactgtcccg
aacaacagcattacacctacatttgctgcagctgccctcttcattgataacgcacgttgg
gatggagttcccttcttgatgaaagctggcaaggctctgcacaaaagaggggccgagatc
cgagtgcaattcaggcatgtgccggggaatctctacaagcggagctttgggacagatctt
gacaaagctaccaatgagttggtgattcgggtgcagcctgacgaggctatctacttgaaa
atcaacaacaaagtgccaggcttagggatgcgattggatcgttcaaatctcaacttacat
tatgccgctaggtataataaggaaattcctgatgcatatgagcggcttatactggacgct
gttgagggtgaacggaggctcttcatcagaagtgatgaattagatgctgcgtgggcatta
tttactcctcttctgaaagagctggagaagcgaaaggtggctccagagctctatccatat
ggcagccgtggtccagtaggcgcccactatttggctgccaaatacaatgttaggtggggc
gacaacagctacgaacctacagagaactga

DBGET integrated database retrieval system