KEGG   Physcomitrella patens subsp. patens: 112292661Help
Entry
112292661         CDS       T01041                                 

Definition
(RefSeq) probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH4
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
ppp03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:ppp00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    112292661
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:ppp03041]
    112292661
Enzymes [BR:ppp01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     112292661
Spliceosome [BR:ppp03041]
 Complex C
  Other components
   Step II factors
    112292661
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HA2 OB_NTP_bind Helicase_C DEAD AAA_22 AAA_19 AAA_30 T2SSE DUF2075 Flavi_DEAD PhoH ABC_tran Sigma54_activ_2 AAA_16 AAA_33 cobW DAP3 AAA_14 Helicase_RecD AAA_25 Sigma54_activat SRP54 NACHT AAA_23 AAA_24 FtsK_SpoIIIE
Motif
Other DBs
NCBI-GeneID: 112292661
NCBI-ProteinID: XP_024397142
Position
15
AA seq 703 aa AA seqDB search
MEGRKLLPINQYEEQIVDAVAKHSVVVVIGETGSGKTTQLSQILHRAGYTKKGMIGVTQP
RRVAAVSVARRVAWEMDVQLGDEVGYSIRFEDRTSKNTLIKYLTDGCLLRECLFDYEFKQ
YSVIILDEAHERSLNTDILLGLLKRIAQNRDTELKVIITSATLDGQKFSEYFHGCPVVNV
PGKLYPVQLLYSTEVPSSYLESAVETAIDVHVREPEGDILVFLTGQDEIEKVLKMLEERV
LMLEEGSCLDAIILPLHASLAPEVQARVFQPAPPNCRRIIVATNVAETSLTVDGVVYVID
PGFVKQRNYNPNTGMDSLSVVRISRVQATQRAGRAGRTRPGKCYRLYPMSAFEEEFLPAT
VPEIQRSSLTGAVLHLKFLDLPNVDILHFDFIDPPLRESLEDALRQLFAIDAIGPDGKIT
ALGKRIAELPLEPALGRTLLAAEDLGCLSQALTVAAMLSAETIFMQGPKKGEDRKRSRED
QQLPNGNNYGDHVQYLQIYELWKKNNFDIKWCRSNNLNIRSMLFAKDVRRQLALITSRKK
FEDDEAMQKIKSARSLRKALCQGYACRLAQRMPKHNGYHTVGNKSQLVQLHPATSPLQVD
EDGLYPEWILYHELMASSRAFLRHVCVVEKEWVVPILEKLQNINIRSLSGLSGHESQKEK
ISEGEKKAIASNPIDQEARSVDVNAARARFLARKQSKSIKSSK
NT seq 2112 nt NT seq  +upstreamnt  +downstreamnt
atggaggggcgcaagctgttgccgataaaccagtatgaggagcagattgtggatgctgtg
gccaagcacagtgttgtggtggtcattggagagacgggttcgggtaaaaccacccaactt
tcgcagattctgcaccgagcagggtacacgaagaaaggcatgattggtgttactcagcct
cggcgagtggctgctgtttctgttgcacgtcgtgtggcttgggaaatggatgttcagcta
ggggacgaagtgggatattctattcgatttgaagaccgaacatccaaaaatacactcata
aagtacttgacggatggttgcttgcttcgtgaatgcttgtttgattacgagttcaaacag
tactctgtcatcattcttgacgaggctcacgagcgcagtttgaatacagacatattgctt
ggcctgttgaagcgtattgctcagaatcgggatactgaattgaaagtgatcattacatct
gccactcttgacgggcagaaattttccgagtattttcacggatgtcctgttgtcaacgtt
cctggcaaattatatcctgtgcaactcctttacagcacagaggtgcctagcagctacttg
gagtctgctgtagagacagcaatcgatgtacatgtcagagaacctgaaggggacatttta
gtttttctcactggacaggatgagatagagaaggttctcaagatgctggaagagagggtt
ctcatgctggaggagggttcctgtcttgacgccataatacttccactacatgcatcttta
gcgccagaggtccaggctcgtgtatttcaaccggcccctcccaattgccggcgcattatt
gtggcgaccaacgttgcagaaacgtctcttactgtggacggtgttgtgtatgtgattgat
cctggatttgtgaagcaacggaactataatcccaacactggcatggactcactttctgtt
gtacgcataagtagggtgcaggccactcaaagggcaggtagagcagggcggacgcgtcca
ggcaagtgttaccgcctttatccgatgtctgcatttgaagaggagtttcttccagccact
gttccagaaattcaacgatcatctctcacgggcgctgtattacatctcaaatttctggat
ctgccaaatgtggatatcctgcacttcgactttatcgatccaccattgagagagtcactg
gaagatgctctacgccagctgttcgcgattgatgctatcggtccagatggtaagattact
gccctcggaaagcgtattgcagagctgccattggaacctgctctaggaaggactttattg
gctgctgaggaccttggttgtctttcccaagccctgactgtggctgccatgctttccgct
gaaacaatcttcatgcaaggaccgaagaaaggtgaagatagaaagaggtctagagaggat
cagcagctgccaaatggaaataattacggggatcatgtgcagtacttgcaaatttatgag
ttgtggaagaaaaataattttgatatcaaatggtgtagaagcaacaatttgaatatcaga
tctatgctcttcgccaaggatgtgagacgtcaactagcacttatcacgtcaaggaaaaaa
tttgaggatgatgaggccatgcaaaagatcaagagtgcacgttcactgcggaaagcttta
tgtcaagggtacgcttgtagattggcgcaacgaatgcccaaacataatgggtatcatact
gttggcaacaaatctcagctggttcagctccatccggcaactagtccgctccaggtggat
gaagatggtctgtatcctgagtggatcctgtaccacgagcttatggccagctcgcgcgct
ttccttcgtcatgtttgtgttgttgagaaagagtgggtggtccctattttggaaaagcta
cagaacattaatattcggagtctcagtggactgagtggtcatgagtcccaaaaggagaaa
atctcagaaggagagaagaaagctattgcatcgaatcccattgatcaggaagcacggtct
gtagatgtcaatgctgcacgcgccagatttcttgcaagaaagcagtctaagtccatcaag
tcttccaaatga

DBGET integrated database retrieval system