KEGG   Physcomitrium patens: 112293662
Entry
112293662         CDS       T01041                                 

Definition
(RefSeq) delta(14)-sterol reductase-like
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
ppp  Physcomitrium patens
Pathway
ppp00100  Steroid biosynthesis
ppp01100  Metabolic pathways
ppp01110  Biosynthesis of secondary metabolites
Module
ppp_M00917  Phytosterol biosynthesis, squalene 2,3-epoxide => campesterol/sitosterol
Brite
KEGG Orthology (KO) [BR:ppp00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    112293662
Enzymes [BR:ppp01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     112293662
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295
Other DBs
NCBI-GeneID: 112293662
NCBI-ProteinID: XP_024399116
Position
16
AA seq 384 aa
MSLFSVVSDPGAFMELYQPLKVDGVELVVLMSVVLGYLGILALLGAVLPGQTIAGTLLAD
KTRVYYKCNGLASLVVMLAGLGIAIKFDYISPTIIADRGGKMCTATFVLCLMMSVWLTLR
GYFTKENSESLKSHATGNIIEDWWLGVQLNPNFLGLDLKFFWIRAGMMGWLLIDFSVAAK
QYIEQGSLSPSMALFQLFCTLYIFDYFWHEEYMTSTWDIIAENFGFMLIFGDLVFIPFTF
SIQAWWLLSHSVDITPTAAAMNVLVFLIGFAVFRSANTQKHKFKQDPKVKIWGKPAKAIG
GRLLVSGCWGISRHCNYLGDILVAFSFSLPCGISSPVPYFYPTYLFILLLWRERRDEARC
STKYKELWKEYCKAVPWRIFPYIY
NT seq 1155 nt   +upstreamnt  +downstreamnt
atgtctctattcagtgttgtctcggatccaggggcattcatggagctgtatcaaccattg
aaagttgatggtgttgagttagttgtgttgatgagcgtggtgttgggctatcttggtata
ctagcgctcttgggcgctgtcttgccggggcaaacgatcgctggcacactcttagcggac
aaaacgagggtctattataaatgcaatgggttggcttcgttggtggtgatgcttgctgga
cttggtatcgcaatcaaatttgattacatttcacctaccattattgcagatagagggggg
aaaatgtgcactgccacgtttgtgctttgtttgatgatgtctgtgtggctgaccttgagg
ggatatttcaccaaagaaaactcagaatctcttaaatcccacgcgactggcaatataatt
gaggactggtggcttggagtgcaattgaacccaaactttctgggccttgacctcaagttt
ttctggattcgagctggtatgatgggttggctgctgattgatttttcagtggctgctaag
cagtacatagaacaaggctcactgtctccatcaatggcactctttcaattattctgcacg
ttatacatttttgattatttctggcatgaggagtacatgacatcaacgtgggacatcata
gctgaaaatttcggatttatgctcatctttggagacttagtcttcattcctttcacattc
agtatccaggcctggtggttgttatcgcactccgtggatattactccgacagctgcagca
atgaacgtcctggtcttccttattggatttgcagtgttcaggagtgcaaacacgcagaaa
cacaagttcaaacaagacccaaaggttaaaatatggggcaaacctgccaaagctattgga
gggcgactgctcgtctctggttgttggggaatctcgagacattgcaactatcttggagac
atcttggtggctttctccttcagtttgccgtgtggcataagctcgccagtgccgtatttc
tatccaacatatctgttcatccttctactgtggagggagcgaagagatgaagcgaggtgt
tcgaccaagtataaggagctttggaaggagtattgcaaagctgttccatggagaattttt
ccatacatatattag

DBGET integrated database retrieval system