KEGG   Physcomitrella patens subsp. patens: 112294068Help
Entry
112294068         CDS       T01041                                 

Definition
(RefSeq) protein MALE DISCOVERER 2-like
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
ppp  Physcomitrella patens subsp. patens
Brite
KEGG Orthology (KO) [BR:ppp00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ppp01001]
    112294068
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase
Motif
Other DBs
NCBI-GeneID: 112294068
NCBI-ProteinID: XP_024399969
Position
2
AA seq 433 aa AA seqDB search
MKQDMWLGACVWSLSIALVSGRVVGTFQGVLRSSEEKQDPERHEPAPLPSLEVNTKAVMW
MNVLLVVTAVALTVAIVVLLLMIHRVQKRRSHTLVSEPCWKSGRILTPFVTTCPLLKREE
LEAACEDFSNIIGSSPDGVLYKGTLADGTEVAVTSIRMSATDWSAYSELSFRRKVESLAR
MKHKHLVNLVGYCSEEVPFTRMLVFEYASNGTLSDHLHNPKEMEHLDWPTRMRVIMGAAY
GLEYMHHDLTPPCSHLNFDANAIYLTDAYATKIANFGIARMTPGKKEYEKGSWMGFKVSE
GYTDEWESSDRHCPGFESNVYNFGVFLLQVISGRPSYCEPVGSTLVDWASPYLADSNLVE
QLLDPELKAHNSDELLALCKIVNLCLSNKGYKRPSMRKVSQMMAEALNMTPEALTMKMSP
LLWAQLSILDDST
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaggatatgtggcttggtgcttgtgtttggtcgctgtctatcgcattagtttcc
ggcagagttgtgggtacattccagggtgtgttacgctcgagcgaggagaagcaggatcct
gagaggcatgaaccggcaccgttgccatcgctcgaggtcaacacgaaggctgtcatgtgg
atgaacgtgcttctggtagtcacggctgtggcattgaccgtcgccatcgtggttctactg
ttaatgattcaccgtgtgcagaagcgacgctcgcataccttggtgtccgaaccttgctgg
aagagtgggaggatactcaccccatttgtgaccacatgcccacttctgaaacgggaggag
ctcgaagcagcgtgcgaggatttcagcaacatcatcggttcctctccagacggagtgttg
tacaaagggacgctcgctgacggcaccgaggtagcggtcacgagcatccggatgtccgcc
acggattggtctgcttactcggagctctccttccgccgcaaagtggagagcctcgcccgc
atgaagcacaagcatttggtgaacctggttgggtattgttccgaagaggttcccttcact
cgcatgctcgtattcgaatacgcctccaacggcaccctctcagatcatctacacaacccc
aaggagatggagcacctggattggccgacacgcatgcgagtcataatgggagccgcttac
gggttggaatatatgcaccacgacttgaccccaccgtgcagtcacttgaacttcgacgcc
aatgctatctatctcacggacgcgtacgctacgaagattgccaattttggcattgccagg
atgacgcccgggaaaaaagagtacgagaagggcagctggatgggcttcaaagtcagtgaa
ggctacaccgatgaatgggagagttccgaccgccattgtcccggatttgagagcaacgtg
tacaacttcggcgtgtttctgcttcaggtgatcagtggtcgaccgtcttactgcgagccc
gtggggtcgacgctggtggactgggcttcgccgtatcttgccgattccaacctggttgaa
cagttgttggatcccgagctcaaggcgcacaactccgacgagttgctggctctatgtaag
atagtgaatttgtgtctctcgaacaagggctacaagaggccgtccatgcgaaaagtgagc
caaatgatggcggaagcactgaacatgaccccggaggcgctaaccatgaagatgtcgccg
ttgctttgggcccagctctcgattctcgacgacagtacatga

DBGET integrated database retrieval system