KEGG   Physcomitrella patens subsp. patens: 112296066Help
Entry
112296066         CDS       T01041                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: polyamine oxidase-like
  KO
K13366  polyamine oxidase [EC:1.5.3.14 1.5.3.16 1.5.3.-]
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
ppp00330  Arginine and proline metabolism
ppp00410  beta-Alanine metabolism
ppp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppp00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    112296066
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    112296066
Enzymes [BR:ppp01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.3  With oxygen as acceptor
    1.5.3.14  polyamine oxidase (propane-1,3-diamine-forming)
     112296066
    1.5.3.16  spermine oxidase
     112296066
    1.5.3.-  
     112296066
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amino_oxidase
Motif
Other DBs
NCBI-GeneID: 112296066
NCBI-ProteinID: XP_024403965
Position
19
AA seq 352 aa AA seqDB search
MAVEMVLDLYHNDYEYAEPPRVTSLKSTQPLPTITNFGEAFQFVHDPRGFKSIVHHLAKS
YLAFNNETITDPRLKFNKVVRKVEYTKKGVKVTTENGXVYTSDYAIVSVSLGVLQSKLID
FVPDLPFWKLKAIYAFDMAVYTKIFLKFPYTFWNIGPGTKFWLYADERRGYYPIWQNLDS
EFPGKNILMVTVTDEESRRIEQQEDSETLQEIMAVLRNMFGSKVPEAESIYVPRWLADPF
FKGTFSNWPIGVESNIFMQLQAPVQTIYFTGEHTSEEYNGYVHGPYLQGIESANSLLNCK
VRGKCGKSEKVYKGLSKECVERLEEERDRQKTLWAKKLAKLQQKLDNATGIH
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atggcagtagagatggtgttagacttatatcacaacgactatgaatacgccgaacctccg
agagtgacgagtttgaagagcacgcagccccttccgacgattaccaattttggagaagct
tttcaattcgttcatgatccccgcggatttaaatccatagtccatcatttggctaaatcg
tatcttgctttcaacaacgagacgatcaccgatccacgcctcaagtttaacaaggttgtt
cgcaaggtggagtataccaaaaagggagtaaaagtgacgacagaaaacggttaagtgtac
acttccgattatgccattgtgtctgttagcctgggcgtgctccagagcaaactgatagac
ttcgtgcccgatttgccgttttggaagcttaaagctatctacgcattcgacatggcagta
tacaccaagatatttttaaaattcccctacacattctggaacatcggtcccgggacgaag
ttttggttgtatgcggatgagcgccgaggctactacccgatctggcagaacttggacagc
gaatttccagggaagaatattctcatggtgactgttacagacgaagagtcccgccgcatt
gagcaacaggaggacagtgaaacactacaagagatcatggctgtgctgcgcaacatgttc
gggtccaaggtccctgaagccgagagcatctacgtgccaagatggttggctgatcccttc
ttcaaaggcaccttctccaactggcccatcggcgtggaatccaacatcttcatgcaactt
caagcgccggtccaaactatctacttcaccggcgagcacacaagcgaggagtacaatggc
tatgttcatggcccttacttgcaaggtatagagtctgcgaactctttactcaattgcaag
gtccgtgggaaatgcggcaagtcagagaaagtgtacaaagggctttcgaaggaatgtgta
gaacgactagaggaggagagagaccgccagaaaacactttgggctaagaagcttgcgaag
cttcaacagaagttagacaatgctactggaatccactga

DBGET integrated database retrieval system