KEGG   Physcomitrella patens subsp. patens: 2546778Help
Entry
2546778           CDS       T01041                                 

Gene name
rpl22, PhpapaCp068
Definition
(RefSeq) ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
ppp03010  Ribosome
Brite
KEGG Orthology (KO) [BR:ppp00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    2546778 (rpl22)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:ppp03011]
    2546778 (rpl22)
Ribosome [BR:ppp03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    2546778 (rpl22)
  Bacteria
    2546778 (rpl22)
  Archaea
    2546778 (rpl22)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-GeneID: 2546778
NCBI-ProteinID: NP_904231
UniProt: Q6YXK7 A0A2R2WV57
Position
CP
AA seq 118 aa AA seqDB search
MKSDKSNLEVRALAKHIRMSAHKARRVVNQIRGRSYEQALMILEFMPYRACYPILQLVSS
AAANANHNLNLNRANLIISEAKVDEGPVLKRFQPRAQGRGYPIHKPTCHITITVKNKN
NT seq 357 nt NT seq  +upstreamnt  +downstreamnt
atgaaatctgacaaatcaaatttagaagtacgagctttggctaaacatatacgtatgtct
gctcataaagcgcgcagagtagttaatcaaattcgcggtcgttcgtatgaacaagcactt
atgatattagaatttatgccatatcgagcatgttatcctatattacaattagtttcttca
gcagcagcaaatgcaaatcacaatttaaatctaaatagagcgaatttaattataagtgaa
gcaaaagtagatgaaggccctgttttaaaaagatttcaacctagagctcaaggacgggga
tatcctatacataaacctacttgtcatataacaattaccgtaaaaaacaaaaattaa

DBGET integrated database retrieval system