KEGG   Paenibacillus polymyxa SQR-21: PPSQR21_012360Help
Entry
PPSQR21_012360    CDS       T03178                                 

Gene name
paaJ
Definition
(GenBank) acetyl-coenzyme a acyltransferase 2
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ppq  Paenibacillus polymyxa SQR-21
Pathway
ppq00071  Fatty acid degradation
ppq00072  Synthesis and degradation of ketone bodies
ppq00280  Valine, leucine and isoleucine degradation
ppq00310  Lysine degradation
ppq00362  Benzoate degradation
ppq00380  Tryptophan metabolism
ppq00620  Pyruvate metabolism
ppq00630  Glyoxylate and dicarboxylate metabolism
ppq00640  Propanoate metabolism
ppq00650  Butanoate metabolism
ppq00900  Terpenoid backbone biosynthesis
ppq01100  Metabolic pathways
ppq01110  Biosynthesis of secondary metabolites
ppq01120  Microbial metabolism in diverse environments
ppq01130  Biosynthesis of antibiotics
ppq01200  Carbon metabolism
ppq01212  Fatty acid metabolism
ppq02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ppq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PPSQR21_012360 (paaJ)
   00630 Glyoxylate and dicarboxylate metabolism
    PPSQR21_012360 (paaJ)
   00640 Propanoate metabolism
    PPSQR21_012360 (paaJ)
   00650 Butanoate metabolism
    PPSQR21_012360 (paaJ)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    PPSQR21_012360 (paaJ)
   00072 Synthesis and degradation of ketone bodies
    PPSQR21_012360 (paaJ)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PPSQR21_012360 (paaJ)
   00310 Lysine degradation
    PPSQR21_012360 (paaJ)
   00380 Tryptophan metabolism
    PPSQR21_012360 (paaJ)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PPSQR21_012360 (paaJ)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PPSQR21_012360 (paaJ)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    PPSQR21_012360 (paaJ)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ppq04147]
    PPSQR21_012360 (paaJ)
Enzymes [BR:ppq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     PPSQR21_012360 (paaJ)
Exosome [BR:ppq04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PPSQR21_012360 (paaJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AHM64896
Position
complement(1451551..1452735)
Genome map
AA seq 394 aa AA seqDB search
MKKVAIVSPLRTAVGSFNKALAPLSAPELGATVMTACLQQSKLEPSLIDQIFMGNVLQAG
NGQNPARQAALKAGIPIDVPESTINTVCGSGLHAVALAYDSILAEQGNIVLAGGMESMSN
APYLLKNARNGYKLGNGELVDSLVADGLTCPINHYHMGITAENVAEKYGISRLEQDAFAY
ESQIKAVEAKNNKVFEEQIVPVMIKNKKETTYFTEDEHIRENTTKEKLSQLKPAFKENGT
VTAGNASGINDGAAAMLVVSEDKCKEHALKPLAYIKGYSLVGVDPAYMGMGPVKAISSLL
KKQGMSIDDIDLFEINEAFAAQALAVQKELGVNPEKVNVNGGAIAIGHPVGASGARVLVT
LVHEMVRRSSRYGVVSLCIGTGMGIAMLVENALI
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagtagctatagtaagcccgttgagaacagcggtcggttcatttaataaagct
cttgcccccctgagcgctcctgaactgggagcaaccgtgatgacagcatgccttcagcaa
agtaaattagagccttctttgattgatcaaatttttatgggaaatgttcttcaagcgggc
aatggtcaaaatcctgccagacaggcggcactaaaagccggtatccccattgatgtaccc
gaatcaacgataaacacggtttgcggttcaggacttcatgccgtcgcgttagcttacgat
tccatattggcagaacaaggaaacatcgtcttggccggtggcatggagagcatgtcgaac
gccccttatctgctaaaaaatgctagaaacggctacaagctcggtaacggtgaattggta
gactccttggtggccgatggcctaacatgcccgatcaaccattaccatatgggaattacc
gccgaaaatgttgccgaaaaatatggaatttcaagacttgagcaagatgcatttgcttat
gaaagccagataaaggctgtcgaagcaaaaaacaacaaggtttttgaagagcaaattgtt
ccggtcatgatcaaaaacaaaaaagaaactacttatttcacagaggacgaacacataaga
gaaaatacgacgaaagaaaaactttctcagttaaaacctgcgtttaaagagaacggaacg
gttactgcgggaaacgcttcgggcatcaatgatggtgcggcggctatgctagtcgtgtcg
gaagacaaatgtaaggaacatgcgttaaagccgttggcatatatcaaaggttactcgctt
gttggtgttgaccctgcatatatgggaatgggaccggtaaaagccatttcgtcactgctg
aagaaacagggaatgtctatagatgacattgatctctttgaaattaacgaagcgttcgct
gcacaagctctagcggtgcaaaaagagcttggagttaatccagagaaagtcaatgtcaat
ggcggcgcgatcgcaatcggtcaccctgttggtgcaagcggtgctagggtattggttacg
ttggttcatgaaatggtacgcagatcttcacgttatggcgtagtctcgttatgcattgga
acgggaatgggaatagccatgctggttgaaaatgctctcatttaa

DBGET integrated database retrieval system