KEGG   Paenibacillus polymyxa SQR-21: PPSQR21_026120Help
Entry
PPSQR21_026120    CDS       T03178                                 

Definition
(GenBank) glycerol dehydrogenase
  KO
K00005  glycerol dehydrogenase [EC:1.1.1.6]
Organism
ppq  Paenibacillus polymyxa SQR-21
Pathway
ppq00561  Glycerolipid metabolism
ppq00640  Propanoate metabolism
ppq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    PPSQR21_026120
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    PPSQR21_026120
Enzymes [BR:ppq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.6  glycerol dehydrogenase
     PPSQR21_026120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 PFK
Motif
Other DBs
NCBI-ProteinID: AHM66254
Position
complement(3028006..3029124)
Genome map
AA seq 372 aa AA seqDB search
MSEKVFISPGKYVQGKNVIDKTGEYVKPLGHTALVIADKLVWEIAADRVVKSLEQADITA
IKVEFQGEASKNEVNRIADEGRSGQVDIVIGVGGGKTLDTAKAVNELLGSSVVIVPTTAS
TDAPTSALSVLYTDEGAFDTYTFFSKNPSLILVDTKVISQAPPLFLSSGIADAMATWIEA
RAVIEARATTMAGGLPTLAAEAIASKCEEVLFDYGLQAYESVKRKVVTPALEAVVEANTL
LSGLGFESGGLAGAHAIHNGFTVLEGDIHHLTHGQKVAFGTLVQLALEKRPLTEVERYID
FYLKLDLPVTLEDIKLQEASREDLYRVAQAATKEGETAHNLPFAVTADDVLDAILAADQY
SVAYKTKIGHRN
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaaaaagtatttattagtccaggtaaatatgtgcaaggaaaaaatgtgattgat
aaaacaggtgaatatgttaagcctttaggccatacggctttggttattgcggacaagctg
gtttgggagattgcagccgatcgagtggtcaaaagtctggagcaggctgatatcactgct
ataaaggttgagtttcaaggagaagcatccaaaaatgaagtaaaccgtattgctgatgag
ggacgaagcggccaggtcgatattgtcattggtgtaggtggcggtaaaacactggatacc
gccaaagccgttaatgagctactcggttcctcggtggtgattgttccaacaaccgcctct
acagatgcccctaccagtgctctatctgttttgtacacggatgagggtgcatttgatacg
tatacctttttcagtaaaaatccgagcttaatcctggttgacacgaaggtcatatctcag
gcaccgcctttgttcctctcctcaggtattgcggatgccatggcaacgtggattgaagcc
cgtgcagtcattgaagctcgtgctacaactatggctggcggcttgccaaccttggcggca
gaagccattgcgtccaagtgcgaggaggttcttttcgattacggactgcaagcttatgaa
tctgtgaagcgcaaagtcgttacaccagcgcttgaagcggtggtggaagccaatacattg
ctaagcggtttgggctttgaaagcggcggcttggcaggtgcacatgccattcacaatggt
tttaccgtactcgaaggagacattcatcacctgacgcatggccaaaaagtagcttttggc
accttagtacagcttgccttggaaaaaagacctttaactgaggtggagcggtatattgat
ttttacctaaaactcgatctgccggttacgctggaagacattaagctgcaggaagcttcc
cgagaggatttgtaccgagtagctcaggctgctaccaaagaaggcgaaaccgctcacaat
ttaccatttgctgttacagcggatgatgtgcttgatgcgattttagcggctgatcagtat
tcagttgcctacaagactaaaattggacatagaaactaa

DBGET integrated database retrieval system