KEGG   Paenibacillus polymyxa SQR-21: PPSQR21_027160Help
Entry
PPSQR21_027160    CDS       T03178                                 

Definition
(GenBank) ribosomal RNA methyltransferase rrmj/ftsj
  KO
K06968  23S rRNA (cytidine2498-2'-O)-methyltransferase [EC:2.1.1.186]
Organism
ppq  Paenibacillus polymyxa SQR-21
Brite
KEGG Orthology (KO) [BR:ppq00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:ppq03009]
    PPSQR21_027160
Enzymes [BR:ppq01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.186  23S rRNA (cytidine2498-2'-O)-methyltransferase
     PPSQR21_027160
Ribosome biogenesis [BR:ppq03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    PPSQR21_027160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FtsJ Methyltransf_25 Methyltransf_11 Methyltransf_23 Methyltransf_24 Methyltransf_31
Motif
Other DBs
NCBI-ProteinID: AHM66358
Position
complement(3142516..3143637)
Genome map
AA seq 373 aa AA seqDB search
MENVLGFGCALEGNVILEELYVNTDEQSESTLSTSRFVCTANHGFAPYAQEELRRLFGSV
KSTMLLPGEIFLATLPAQEIETVKTITGQPPMFLRHLFPVHFQEEGTDLVQVQERLVAFI
RNRRELIDQRVSLQVRKGSNSSWAESAGALKLALSEQLSDLPMELVVHGADVIVSVFADT
DTWYAGVSHPQDNLSDWSGGAVRFQKEDGQISRAKFKLLEAEATFGIDFSAFHQGLDIGA
APGGWTSFLLERGLKVTAVDPAKMEPSLMKYANLTFLRKNASEVKFKENSFDLLVCDMSW
SPKQMARLVTDLLYSLRSGGTAIVTVKLMHKKPLALIHDVIASFEESGMQIQRAKQLFHN
RDEITLYMIKYGK
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atggagaacgtccttggattcgggtgtgcgctggagggtaacgttattttggaggaacta
tacgtgaatacagatgaacagagtgagtccactttgtcgacatcgagatttgtttgtacg
gccaaccatggttttgcaccctatgctcaggaggagcttagaagattatttggctctgtg
aaaagcacgatgcttctacctggtgaaatttttctagcaacattacctgcgcaagaaatt
gagacagtgaagacgattacaggtcagccaccgatgtttctgcgtcacttgtttcctgtt
cattttcaggaggaaggtacggatctggttcaagtgcaagagcgtctggttgcatttatc
cgtaaccgcagggaattgatagatcaacgtgtttctttgcaagtacgcaaaggatctaat
agcagttgggctgaaagcgcaggtgcgctcaagctggctttgagtgaacaattaagtgat
ctacctatggaattggtagtacatggcgccgatgttattgtgtccgtttttgcagataca
gatacgtggtacgcaggcgtatcacatcctcaggacaacctatcagattggagcggaggt
gcagttcgttttcagaaggaagacggacagatctcgcgtgccaaattcaagctactggaa
gcagaagcaacgttcggcattgattttagcgctttccatcagggactggatattggggca
gcaccgggtggatggacttccttcttgctggagcgtggactgaaagttacagcggttgat
ccggccaagatggagccatcgctgatgaagtacgccaatctgacatttttgcgtaaaaat
gcaagtgaagtcaaatttaaagagaattcgttcgatctgctggtttgtgatatgagttgg
agtccaaaacagatggcaaggctcgttactgatttactgtatagtttgcggagtggtggt
acggctatcgtaacagtcaagctaatgcataaaaagcccttggcgcttattcatgatgtg
attgcttcctttgaggagtccggcatgcagattcagcgagccaaacagcttttccataac
cgagatgagattaccctgtatatgatcaagtatggaaaataa

DBGET integrated database retrieval system