KEGG   Paenibacillus polymyxa SQR-21: PPSQR21_027220Help
Entry
PPSQR21_027220    CDS       T03178                                 

Gene name
nagD
Definition
(GenBank) HAD-superfamily hydrolase-like protein
  KO
K01101  4-nitrophenyl phosphatase [EC:3.1.3.41]
Organism
ppq  Paenibacillus polymyxa SQR-21
Pathway
ppq00627  Aminobenzoate degradation
ppq01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ppq00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    PPSQR21_027220 (nagD)
Enzymes [BR:ppq01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.41  4-nitrophenylphosphatase
     PPSQR21_027220 (nagD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_6 Hydrolase_like Hydrolase HAD_2 PGP_phosphatase
Motif
Other DBs
NCBI-ProteinID: AHM66364
Position
complement(3146813..3147553)
Genome map
AA seq 246 aa AA seqDB search
MIKGADLFISRLRSEHIPYAYVTNNASRTPESVAEHLIGMGIEAASHEVYTSALAAAQYV
AQQSPGAHVYCIGETGLREALTGAGLQLVQNHPDYVVQGIDRQFTYETLAAAMRWIREGA
TFILTNPDLQLPSHDGLTPGAGTIGAAIEAASQVKPVVIGKPSSVLMNYALNRLSIRADE
ALVVGDNMLTDIAAGAAAGCKTALILTGVTTRANMDEHIRAVGVKPDLMFESLDELQEWM
QKELKS
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgatcaagggtgcggatctgttcatttcgcgattgcgttcagagcatataccttatgca
tatgtcaccaacaatgcttcacgcacacccgaatcggtggccgagcatttgattggtatg
ggaattgaagcagctagtcatgaagtatatacttcagcgttagcagctgcacaatatgtt
gcacagcaaagccctggagctcatgtatattgtattggtgaaacgggattacgcgaggca
ctcacaggggctggcttgcagcttgttcagaatcatcctgattatgtggtacaggggata
gatcgtcaatttacatatgaaacgctggcagctgccatgcgttggattcgtgagggagct
acatttattttgacaaatccggatctacaattgccttcgcatgacgggcttacaccaggt
gcaggtaccattggagctgccattgaagctgcttcacaggtcaaaccggtcgtcatcggc
aagccttcaagcgtgctaatgaattatgcactaaatcgcttgagcattagagcggatgaa
gctctggttgtgggcgataatatgcttacagatattgcggcaggtgcagcagcaggttgt
aaaacagctctgattctgacgggtgtgacgactcgcgctaatatggatgaacatattcgt
gccgttggagtaaaacctgacctgatgtttgaaagtttggacgaactgcaggaatggatg
caaaaagagctgaaatcataa

DBGET integrated database retrieval system