KEGG   Paenibacillus polymyxa SQR-21: PPSQR21_033300Help
Entry
PPSQR21_033300    CDS       T03178                                 

Definition
(GenBank) RNA pseudouridine synthase ylyb
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
ppq  Paenibacillus polymyxa SQR-21
Brite
KEGG Orthology (KO) [BR:ppq00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:ppq03009]
    PPSQR21_033300
Enzymes [BR:ppq01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     PPSQR21_033300
Ribosome biogenesis [BR:ppq03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    PPSQR21_033300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 S4 ThiS-like
Motif
Other DBs
NCBI-ProteinID: AHM66968
Position
complement(3793314..3794285)
Genome map
AA seq 323 aa AA seqDB search
MNEVNENGEAIGLSYEDELEGESLEWTADSEDVKTRIDKYIAEEMKEVSRSQIQLWIGNG
RVLVNGAAVKANYKLAEGDHIVLSVPEPESVDIMPENIPLDVVYEDSDVIVINKQRGLVV
HPAPGHSSGTLVNALMYHCHDLSGINGELRPGIVHRIDKDTSGLLMAAKNDQAHASLAAQ
LKDHSVTRKYIALVHGHLSHDQGTVDAPIGRDSGDRKLFTVTERNSKHAVTHFLVIERLG
DYTLLELQLETGRTHQIRVHMKFIGHPLVGDPMYGRSKGVRMDGQALHAAVLGFKHPTTG
GYLEFSRPIPPDMEDVLTSLRSR
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaagtgaatgaaaacggcgaagccataggtctgtcttatgaggacgaactggag
ggtgaatctctggaatggacagcggattcagaggatgtcaaaacacgtatagataaatac
atcgccgaagaaatgaaggaagtgtctcgttcccagatccagctgtggattgggaatggt
cgggtactggtgaacggtgcggcggtcaaagcgaactacaagctggctgaaggagatcat
atcgtactatcggtacctgaaccagaaagtgtagatattatgccggaaaatattccgcta
gatgtcgtatacgaggattcggacgttattgtcattaacaagcaacgtggtctagttgtg
catcctgcaccaggacactcctcgggaacactggtcaacgcactgatgtaccactgccat
gacctttccggcattaacggggaattacgtcccggtattgttcaccgtattgataaggat
acatcaggactgctgatggcagctaaaaatgatcaggcccacgcatcacttgcagcacag
ctgaaggatcatagcgtgactcggaaatatatagcattggtccacggtcatttgagtcac
gatcagggaactgtagatgctccgattggtcgtgattcaggtgaccgtaaattgttcacg
gttacggaacgcaacagcaagcatgcagttacccattttctcgtcattgaacggttaggt
gattataccctgcttgaacttcaattggagacaggacggacacaccaaattcgtgttcac
atgaaattcattggacatccattggttggcgaccctatgtatggacgcagtaaaggggtt
cgtatggatggccaagcgctgcatgcagcggttctgggatttaagcatccaactactgga
gggtacttagaatttagcagaccgatccctcctgatatggaggacgtattaacgtccttg
cgtagtcgctaa

DBGET integrated database retrieval system