KEGG   Paenibacillus polymyxa SQR-21: PPSQR21_036610Help
Entry
PPSQR21_036610    CDS       T03178                                 

Definition
(GenBank) molecular chaperone GroES
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
ppq  Paenibacillus polymyxa SQR-21
Pathway
ppq00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:ppq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    PPSQR21_036610
Enzymes [BR:ppq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     PPSQR21_036610
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     PPSQR21_036610
    1.1.1.-  
     PPSQR21_036610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C TrkA_N ADH_N_assoc 2-Hacid_dh_C Sacchrp_dh_NADP Shikimate_DH
Motif
Other DBs
NCBI-ProteinID: AHM67299
Position
4162566..4163618
Genome map
AA seq 350 aa AA seqDB search
MQALRWHGVKDLRLENIEQPAALPGKVKIKVEWCGICGSDLHEYVAGPIFIPENAQHPLT
GEKAPIVMGHEFSGQVVEIGEGVTKIQVGDRVVVEPVFACGECDACRQGKYNLCDKMGFL
GLAGGGGGFSEYVAADEHMVHKIPESVSFEQGALVEPSAVALYAVRQSQLKVGDKAVVFG
AGPIGLLVIEALKASGASEIYAVELSEERKAKAEELGAIVLDPKTYDVVEELHKRTNGGV
DVAYEVTGVPPVLTQAIESTKISGQIMIVSIFEKEAPIKPNNIVMKERNLTGIIGYRDVF
PAVISLMEKGYFPADKLVTKRIKLEEVIEQGFEGLLKEKNQVKILVSPKA
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcattgagatggcatggagtaaaagatttacgtttggaaaacattgagcaaccc
gctgctcttccggggaaagtaaaaattaaagtggaatggtgtggcatttgcggaagtgat
cttcacgaatatgtagcaggaccgatcttcattcctgaaaacgctcagcatccactgact
ggcgaaaaagctccgattgtgatgggacatgaattttctggacaagtcgttgaaatcggt
gaaggtgtaaccaagattcaggttggcgaccgtgtagtcgtagaaccggtttttgcatgt
ggagaatgtgatgcatgtagacaaggcaaatataacctttgcgataaaatgggcttcctc
ggtttggcaggcggcggcggtggattttctgaatatgtcgcagctgacgagcacatggtt
cacaaaattccagaaagcgtatccttcgagcaaggcgctttggtagagccttcggccgtt
gctttgtacgctgtacgtcaaagccaactgaaagtcggcgacaaagctgtcgtgtttggc
gctggtcctatcggattgctggttattgaagcgttgaaagcttcgggcgcatctgagatt
tatgcagtagagctttccgaggagcgtaaagctaaagctgaagagctgggtgctattgtg
cttgatcctaaaacttatgatgttgtggaagaactgcacaaacggaccaacggtggcgta
gatgtagcctatgaagtcactggagtacctcctgtgctgactcaagcgattgaatccact
aaaattagcggacaaatcatgatcgtcagcatttttgaaaaagaagctccaatcaaaccg
aacaatatcgttatgaaggaacgcaatctgactggtattatcggctaccgtgatgtattc
ccggctgtcatcagcttgatggaaaaagggtatttccctgctgacaagcttgtgaccaaa
cgtattaagctcgaagaagtaatcgagcaaggttttgaaggtctcctgaaagaaaaaaat
caggttaaaatcctggtatctccgaaagcctaa

DBGET integrated database retrieval system