KEGG   Photobacterium profundum: PBPRA0256
Entry
PBPRA0256         CDS       T00173                                 
Symbol
PLU4760
Name
(GenBank) putative transcriptional repressor, LacI family
  KO
K05499  LacI family transcriptional regulator, repressor for deo operon, udp, cdd, tsx, nupC, and nupG
Organism
ppr  Photobacterium profundum
Brite
KEGG Orthology (KO) [BR:ppr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ppr03000]
    PBPRA0256 (PLU4760)
Transcription factors [BR:ppr03000]
 Prokaryotic type
  Helix-turn-helix
   LacI family
    PBPRA0256 (PLU4760)
SSDB
Motif
Pfam: Peripla_BP_3 Peripla_BP_1 LacI Peripla_BP_4 HTH_AraC HTH_38 HTH_Tnp_ISL3 ClpB_D2-small HTH_Crp_2
Other DBs
NCBI-ProteinID: CAG18695
UniProt: Q6LVI0
Position
1:complement(262733..263737)
AA seq 334 aa
MATMKDVAQLAGVSTATVSRALMNPEKVSASTRKKVEQAVMEAGYSPNSLARNLRRNESK
TIVTIVPDICDPYFTEIIRGIEEAAMEHGYLVLLGDSGQQKTRENSFVNLVFTKQADGML
LLGTDLPFDVSKPEQKNLPPLVMACEYAPELELPTVHIDNLTAAYEAVNYLTQMGHKRIA
QISGPDQAALCQFRSQGYQQALRRGGIELNPAYTVKGDFSFAAGARAVTALLSLPEPPTA
LFCHSDVMAIGAMQQAKRLGLRVPQDLSIVGFDDIQFAEYCDPPLTTVSQPRYEIGRQAM
LMLLELLKGKDVRAGSRLLDAKLVIRESAAPPSM
NT seq 1005 nt   +upstreamnt  +downstreamnt
atggcgacaatgaaggacgttgcccagctagctggagtatctactgctacggtttcccgt
gcgttaatgaacccagaaaaggtctcggcatcgacccgtaaaaaagtcgaacaagccgtt
atggaagctggttattcccccaactcactggcgagaaacctacgccgcaatgaatcaaaa
accatcgttactatcgtacccgacatctgtgatccctacttcacagagattatccgtggt
atcgaagaagctgcgatggaacacggctacttagtcttgctcggtgatagcggacaacag
aaaacccgcgaaaattcatttgttaatttagttttcaccaagcaagctgacggtatgctg
ctgctgggcactgatttaccgtttgatgtcagcaaacccgaacaaaaaaacctacctcca
ttagtaatggcatgtgaatatgcgccagaacttgagctgccaactgttcatatcgataac
ttaactgccgcctatgaagccgtaaactatttaactcagatgggtcataagcgtattgcg
caaatttctggtcctgatcaagcagcactgtgtcaatttcgctcacaaggttatcagcaa
gcacttcgtcgtggtggtatagagttgaaccccgcttacaccgttaaaggtgatttctcg
tttgcggcaggagcacgggctgttacagccctactttcattacctgagccaccaacagca
ctattctgtcacagtgatgtgatggccattggtgcaatgcaacaagccaaacgtcttggt
ttacgcgtaccgcaagatctgtccattgtgggctttgatgatattcaatttgcagaatat
tgcgatccaccgttaaccactgtttctcagccgcgttatgaaattggtcgccaagcaatg
ttgatgctacttgaactattgaaaggcaaagatgttcgtgctggctcgcgtttactggat
gcaaaactggtcattcgcgaaagtgccgcgccaccatcaatgtaa

DBGET integrated database retrieval system