KEGG   Photobacterium profundum: PBPRA2750
Entry
PBPRA2750         CDS       T00173                                 

Symbol
YPO1383
Name
(GenBank) putative formate acetyltransferase
  KO
K00656  formate C-acetyltransferase [EC:2.3.1.54]
Organism
ppr  Photobacterium profundum
Pathway
ppr00620  Pyruvate metabolism
ppr00640  Propanoate metabolism
ppr00650  Butanoate metabolism
ppr01100  Metabolic pathways
ppr01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ppr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PBPRA2750 (YPO1383)
   00640 Propanoate metabolism
    PBPRA2750 (YPO1383)
   00650 Butanoate metabolism
    PBPRA2750 (YPO1383)
Enzymes [BR:ppr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.54  formate C-acetyltransferase
     PBPRA2750 (YPO1383)
SSDB
Motif
Pfam: PFL-like Gly_radical
Other DBs
NCBI-ProteinID: CAG21122
UniProt: Q6LNK4
Position
1:3189946..3192222
AA seq 758 aa
MAEQFAKAWEGFAAGEWQNDVNVRDFIQKNYTPYVGDESFLESEATPATAKLWEQVMVGI
KQENSTHSPVDFDTSVISTITSHDAGYINKDLETIVGLQTEAPLKRAIIPNGGIRMVEGS
CKAYDRELDPEVSKIFTEYRKTHNQCVFDIYTPDIMKCRKSGVLTGLPDAYGRGRIIGDY
RRVALYGIDRLMKDKFAQFTSLQERFELGEDLQMTMQLREEIAEQHRALGQIKTMAAKYG
YDISGPATSAQEAIQWTYFGYLAAVKSQNGAAMSLGRTSTFLDVYIERDIAAGVITEVQA
QEMIDHFVMKLRMVRFLRTPEYDELFSGDPIWATESMGGMGLDGRTLVTRSNFRFLNSLY
TMGPSPEPNITVLWSEQLPDGFKRFCAKVSIDTSSIQYENDDLMRPDMDSDDYAIACCVS
PMIVGKQMQFFGARANLAKTMLYSINGGVDEKLKIQIGPKTAPVTDEVLDYADVMDRLDH
FMDWLATQYVTALNSIHYSHDKYSYEASLMALHDRDVRRTMACGIAGLSVAADSLSAIKY
AKVKPIRDEDGISIDFEIEGDYPKFGNNDSRVDDIACELVSTFMGKIRKLKMYRDAIPTQ
SILTITSNVVYGKKTGNTPDGRRAGAPFAPGANPMHGRDEKGAVASLTSVGKLPFADAKD
GISYTFSIVPNALGKEVDTQKANLAGLMDGYFHHEAGIEGGQHLNVNVLNRETLLDAVEH
PENYPQLTIRVSGYAVRFNSLTTEQQKDVIARTFTASL
NT seq 2277 nt   +upstreamnt  +downstreamnt
atggcagagcaatttgctaaagcttgggaaggtttcgctgcaggcgaatggcagaacgat
gtaaacgttcgtgatttcatccaaaagaactacacaccgtatgtcggtgacgagtctttc
ctagaatctgaagcaacgccagcaacggcaaagctttgggaacaagttatggtaggtatc
aagcaggaaaacagcactcactctcctgttgatttcgatacttcggttatttctaccatc
acgtcacacgatgcaggttacatcaacaaagatcttgaaacgattgttggtcttcaaact
gaagctccacttaagcgcgctatcatccctaacggtggtatccgtatggttgaaggttct
tgtaaagcgtacgatcgcgaactagatcctgaagtttctaaaatctttactgaataccgt
aaaacacacaaccagtgtgtattcgatatttacacgcctgacatcatgaaatgtcgtaag
tctggtgtactgactggtcttccagatgcatacggccgtggtcgtatcattggtgattac
cgtcgcgtagcactatacggtatcgatcgtctaatgaaagacaagttcgctcaatttacg
tctctacaagagcgtttcgagttaggcgaagatcttcaaatgacaatgcaacttcgtgaa
gaaattgcagagcaacaccgtgctctaggtcagatcaaaactatggcagctaaatacggc
tacgatatttctggtcctgctacaagtgcacaagaagcaattcaatggacttacttcggc
tacctagctgcggttaaatcacagaacggtgctgcaatgtctctaggtcgtacttctacg
ttcctagatgtgtacattgagcgtgatatcgcagctggcgtaatcacagaagttcaagca
caagaaatgattgaccacttcgtaatgaagctacgtatggttcgtttcctacgtacgcct
gaatacgatgagttgttctctggtgacccaatctgggcaacagaatcaatgggtggtatg
ggtcttgatggtcgtacattagttacgcgttcaaacttccgtttcctaaacagcctatac
actatgggtccttctccagagccgaacatcactgttctttggtctgagcagctacctgat
ggtttcaagcgtttctgtgcaaaagtatctatcgatacttcttctatccagtacgaaaac
gatgatctaatgcgtccagacatggactcagatgactacgcaatcgcttgttgtgtatcg
ccaatgattgttggtaagcaaatgcagttcttcggtgcacgtgctaaccttgctaaaaca
atgctttactctatcaacggcggcgttgatgagaagcttaaaatccaaatcggtcctaag
actgcgccagtaactgacgaagttctagactacgctgatgtgatggatcgtctagatcac
ttcatggattggttagcaacacaatacgtgactgcactaaacagcattcactacagccac
gacaagtacagctacgaagcatcactaatggcgcttcatgaccgtgacgttcgtcgtaca
atggcttgtggtattgcaggtctttctgttgcagctgactcattgtctgctatcaagtac
gcaaaagttaagcctatccgtgacgaagacggtatttctatcgacttcgaaatcgaaggt
gattaccctaaattcggtaacaacgattcacgtgtagatgacatcgcttgtgaactagtt
tcaacatttatgggcaaaatccgtaagttgaaaatgtaccgtgatgctatccctactcag
tcaatccttacgattacatctaacgttgtatacggtaagaagacgggtaacactccagat
ggtcgtcgtgctggcgctcctttcgcaccaggtgcaaacccaatgcacggccgtgatgag
aaaggtgctgtagcctctctaacatctgtaggtaaactaccgtttgctgacgcaaaagat
ggtatctcttacacattctctatcgtgccaaacgcgctaggtaaagaagtagatactcaa
aaagctaaccttgcaggtcttatggatggttacttccaccatgaagcaggcatcgaaggc
ggtcagcacttgaacgttaacgtattaaaccgtgaaacgcttcttgatgccgttgagcac
ccagagaactacccacagctaactatccgtgtatcgggttacgcagtgcgtttcaactct
ctaacaactgaacagcagaaagacgtaatcgcacgtactttcactgcatctctataa

DBGET integrated database retrieval system