KEGG   Photobacterium profundum: PBPRA0191Help
Entry
PBPRA0191         CDS       T00173                                 

Gene name
GMK
Definition
(GenBank) putative guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
ppr  Photobacterium profundum
Pathway
ppr00230  Purine metabolism
ppr01100  Metabolic pathways
Module
ppr_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:ppr00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    PBPRA0191 (GMK)
Enzymes [BR:ppr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     PBPRA0191 (GMK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin RsgA_GTPase AAA_22 AAA_16 ABC_tran AAA_18 AAA_33 MMR_HSR1 Dynamin_N cobW AAA_29 CPT DUF2315 AAA_23
Motif
Other DBs
NCBI-ProteinID: CAG18630
UniProt: Q6LVP5
Position
1:complement(197313..197939)
Genome map
AA seq 208 aa AA seqDB search
MSKGTLYIVSAPSGAGKSSLINALLETNPTYDMKVSVSHTTRGMRPGEENGVHYNFISVE
EFTELTEQESFLEHAEVFGNYYGTSRPWIEDQLNKGIDVFLDIDWQGARQIRIQMPAAKS
LFILPPSKEELERRLNARGQDSETIIARRMQEARSEISHYNEYDYVIVNDDFDAALMDFK
AIIRAERLKQDKQTAKYNSMLNALLAEQ
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaggtactctatacatcgtgtcggcaccaagtggcgctggtaaatcaagtttg
attaatgcgctgcttgaaactaatccgacctatgacatgaaagtatccgtttcccacacg
actcgcggtatgcgacctggtgaagaaaatggtgttcattacaattttattagtgttgaa
gagttcacagaactaaccgaacaagagtcattccttgaacatgctgaagtatttggtaat
tattacggtacatcacgcccttggattgaagaccagctgaacaaaggtattgatgtcttt
ttagatattgattggcagggtgcgcgtcaaatccgcatacaaatgccagcggcgaaaagc
ctcttcattttaccaccttcaaaagaagaattagagcgtcgtttaaatgctcgtggtcaa
gacagtgaaaccataattgcacgtcgtatgcaagaagctcgttctgaaatctctcattac
aacgaatatgactatgtcatcgttaatgatgatttcgatgctgcgttaatggactttaaa
gccattattcgtgcagaacgattgaagcaagacaagcaaactgctaaatataacagtatg
ctaaatgctctactggcagaacagtaa

DBGET integrated database retrieval system