KEGG   Photobacterium profundum: PBPRA0261Help
Entry
PBPRA0261         CDS       T00173                                 

Gene name
Z5494
Definition
(GenBank) putative cystathionine gamma-synthase
  KO
K01739  cystathionine gamma-synthase [EC:2.5.1.48]
Organism
ppr  Photobacterium profundum
Pathway
ppr00270  Cysteine and methionine metabolism
ppr00450  Selenocompound metabolism
ppr00920  Sulfur metabolism
ppr01100  Metabolic pathways
ppr01110  Biosynthesis of secondary metabolites
ppr01130  Biosynthesis of antibiotics
ppr01230  Biosynthesis of amino acids
Module
ppr_M00017  Methionine biosynthesis, apartate => homoserine => methionine
Brite
KEGG Orthology (KO) [BR:ppr00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    PBPRA0261 (Z5494)
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    PBPRA0261 (Z5494)
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    PBPRA0261 (Z5494)
Enzymes [BR:ppr01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.48  cystathionine gamma-synthase
     PBPRA0261 (Z5494)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cys_Met_Meta_PP Aminotran_5 Aminotran_1_2 GDC-P Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: CAG18700
UniProt: Q6LVH5
Position
1:268837..270003
Genome map
AA seq 388 aa AA seqDB search
MSDKQLATIAVRTGIESDSQHNAVVPPIYLTSTYSFPKLGELPQYDYSRSGNPTRNMLAD
ALSDLEGGASGVVTSCGTAAINLLVSALLSPDDLIIAPHDCYGGTYRLFNTRANKGDFNV
LFIDQSDPVALTQALAKKPKIVWVETPSNPLLRVIDVEALCQQAKAVGAQVAVDNTFLSP
LLQQPIKLGADFVVHSTTKYINGHSDVVGGVLISKDAEQAENIAWWANCIGATGAPFDAY
LTLRGLRTLGARMRMHEENGAEILKYLQTNALVGQIYHPSLPEHPGHDIAARQQKGFGSM
LSFELAGTYRQLEVFVEALTLFSLAESLGGTESLIAHPSSMTHRAMSDEAQAEAGIKTSL
LRLSVGLEDPQDLINDLEQAFTLAAEAV
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacaagcaacttgccaccatcgctgtgcgcacaggtatcgaatcagacagtcaa
cacaatgctgttgtaccacctatctatttgacatcgacttatagtttcccaaagctcggt
gagttaccgcagtacgattattctcgatcaggcaatcctacgcgtaatatgctagcagat
gccttatctgatcttgaaggtggtgcgagtggcgttgtgacgagctgtggaaccgctgca
attaacttgctcgtatcggccttgcttagccctgatgatttaattattgccccgcatgat
tgttatggtggtacttaccgcctgtttaatacgcgtgctaataaaggcgattttaacgtt
ttatttatcgaccagtcagatcccgtagcgcttactcaagcgctggcgaaaaaacctaaa
attgtttgggttgaaacgccatcaaacccgttattacgtgtgattgatgtggaagcattg
tgtcaacaagcgaaagcggttggcgcacaggttgccgttgataacacctttctttctccg
cttttacagcaacctattaaattaggggctgattttgtggttcactcgacaacaaaatac
atcaatggtcattcggatgttgttggtggcgttttaatttcaaaagatgctgaacaagca
gaaaacattgcttggtgggcaaattgtattggtgcaacgggtgcaccgtttgatgcttat
ctaacgttacgtggtttacgtaccttaggtgcaagaatgcggatgcatgaagaaaatggt
gccgagatccttaagtatctacaaacaaatgcactggttggtcaaatttatcaccctagt
ttgcctgagcacccaggtcatgacattgcagcacgtcagcaaaaaggatttggttctatg
cttagctttgagctagctggcacctaccgtcaacttgaagtctttgttgaagcgttaaca
ttattctcattggctgaatcattaggtggaaccgaaagtttaattgcgcatccatcaagc
atgacacaccgtgctatgtctgatgaagcacaagcagaagccggtattaaaacgtcactg
ttacgcctttctgttggtttggaagatcctcaagatttaatcaacgatcttgaacaagca
tttactctggctgcggaggcggtgtaa

DBGET integrated database retrieval system