KEGG   Photobacterium profundum: PBPRA0443Help
Entry
PBPRA0443         CDS       T00173                                 

Gene name
CBU0014
Definition
(GenBank) putative phosphate/sulphate permease
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
ppr  Photobacterium profundum
Brite
KEGG Orthology (KO) [BR:ppr00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    PBPRA0443 (CBU0014)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: CAG18874
UniProt: Q6LV01
Position
1:complement(457627..458895)
Genome map
AA seq 422 aa AA seqDB search
MEILANYGTILILVAAIFGLLMAIGIGANDVANAMGTSVGSKALTVKQAIIIAMIFEFAG
AYLAGGEVTDTIRKGVIDMSFYADQPEVLVYGMMSALLAAGTWLLLASYMGWPVSTTHSI
IGAIIGFACISVGTEAVDWQSVQGIVGSWLITPLISGLFAYLIFVSAQRLIFDTDSPLIN
AKRFVPIYMFITAMVIALVTITKGLKHVGLHLSSGEAWAASAAVSAVIMIFGYIYISKKY
TDDGSSVDSNGYAGVERVFSLLMVVTACAMAFAHGSNDVANAIGPLSAVVSTVQNMGQIA
EKTTIAWWILPLGGVGIVIGLATMGHKVMATVGTGITELTPSRGFAAQLATASTVVLASG
TGLPISTTQTLVGGVIGVAVARGIGALNLGVVRNIVASWVVTLPAGALLAVIFFYIIQAI
FG
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atggaaatcctggctaactacggcaccattcttattttggtggcggctatcttcggtctt
ttgatggcgattggtattggtgcaaatgatgttgccaatgctatgggtacttcagtaggt
tcaaaggcacttaccgttaaacaagcaatcatcattgcgatgatttttgaattcgcaggt
gcttaccttgcgggtggtgaagtaacagatacgatccgtaagggtgttatcgacatgtcg
ttttatgctgatcaaccagaagttttggtttacggtatgatgtcagctcttcttgctgct
ggaacatggttattgctggcttcttatatgggctggccagtatcaacaacacactcaatc
atcggtgctatcatcggttttgcgtgtatttcagttggtactgaagctgtggattggcag
tcggtacagggcattgtcggtagctggcttattactccattaatttcaggtctctttgct
tacctgatctttgtcagtgctcagcgcctcatattcgatactgatagccccttgataaat
gccaagcgttttgttcctatttatatgtttatcactgcgatggtcattgcgttggtaaca
attacaaaaggtctaaaacacgttggattacatctatcaagtggtgaagcttgggcggca
tcggctgctgtatctgctgtaattatgatctttggttatatctatatcagcaaaaaatac
actgacgatggtagctcagttgatagcaatggctatgctggcgtagaacgcgtattcagc
ctattaatggttgttacagcgtgtgcgatggcatttgcgcatggttccaatgatgtcgct
aatgcgattggtccactgtctgcggttgtatcaaccgttcagaacatgggacaaatcgca
gagaaaacaacaatagcatggtggattctaccattaggtggtgtcggtattgttattggt
ctagcaacaatggggcataaagtaatggctaccgttggtactggtattactgaactaaca
ccaagtcgaggcttcgctgctcagttagcaacagcatcaacggtggtattagcctctggt
actggtttaccaatctctacaacacaaacgttagttggtggtgtaattggtgtcgccgtt
gctcgtggtattggagcgttgaacttaggtgtcgtgcgtaacatcgtcgcgtcttgggtt
gtaacgttacctgctggtgccctacttgctgttattttcttctacatcatacaagctatt
tttggttaa

DBGET integrated database retrieval system