KEGG   Photobacterium profundum: PBPRA0659
Entry
PBPRA0659         CDS       T00173                                 

Gene name
BB0813
Definition
(GenBank) hypothetical protein
  KO
K11906  type VI secretion system protein VasD
Organism
ppr  Photobacterium profundum
Pathway
ppr03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ppr00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PBPRA0659 (BB0813)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ppr02044]
    PBPRA0659 (BB0813)
Secretion system [BR:ppr02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PBPRA0659 (BB0813)
SSDB
Motif
Pfam: T6SS-SciN Reo_sigma1
Other DBs
NCBI-ProteinID: CAG19080
UniProt: Q6LUE5
Position
1:723258..723725
AA seq 155 aa
MPKFIKMVIVFAFMSVLLFGCSVANLVVDPYTTLEFEVSNKVNPDLNGRASPVVVKVYEL
QSKTIFESQDFFMIYDESDKIFGPDLLSKDELSLSPGENFKYDLKMSSGSKYVGIVVAYR
DLENSKWREIIKLDHEGYNTHDLMVDSLSVHVKKP
NT seq 468 nt   +upstreamnt  +downstreamnt
atgcctaaatttattaagatggtaatcgtttttgcttttatgtctgtattgttatttggg
tgcagtgttgcaaatcttgttgttgacccttatacaacgttagaatttgaggtgagtaat
aaagttaaccctgacttgaatggtcgagcatcgccagttgttgttaaagtttatgagttg
caatctaaaacgatctttgaaagccaagatttttttatgatttatgatgaatccgataaa
atattcggcccagatttactttctaaagatgaattgtcgttatctccgggtgaaaatttt
aagtatgatttaaaaatgtcatcaggaagtaaatatgtaggaatagtagttgcctatcga
gatcttgaaaattcaaaatggcgagaaataattaagttagaccatgaaggatataataca
catgatctgatggttgattcattatcggtgcatgtgaagaaaccataa

DBGET integrated database retrieval system