KEGG   Photobacterium profundum: PBPRA0666
Entry
PBPRA0666         CDS       T00173                                 

Gene name
RSP0743
Definition
(GenBank) conserved hypothetical protein
  KO
K11901  type VI secretion system protein ImpB
Organism
ppr  Photobacterium profundum
Brite
KEGG Orthology (KO) [BR:ppr00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ppr02044]
    PBPRA0666 (RSP0743)
Secretion system [BR:ppr02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PBPRA0666 (RSP0743)
SSDB
Motif
Pfam: T6SS_VipA RNase_H_2
Other DBs
NCBI-ProteinID: CAG19087
UniProt: Q6LUD8
Position
1:732758..733291
AA seq 177 aa
MESIHKKLSRVRKPRVHITYDVETEGLTVKKELAFVVGVMGDFAGQNTEALKPLKDRRFI
QIDRDNFDDVLKRMSPRLNFKVDNKLMNDGTELSLSLAFNSMQDFEPAAIVNQVEPLKKL
LETRTKLRDLMTKIDRSEDLENVLEKVLNNTDNLSQLANELNVGNDNPEKQPEGEGA
NT seq 534 nt   +upstreamnt  +downstreamnt
atggaaagtatccacaagaagttgtctcgggtacgaaaaccgcgtgttcacattacttat
gatgtggaaactgaaggattaacggtcaaaaaagaattggccttcgtcgtgggtgtaatg
ggggactttgcgggtcaaaataccgaggcattgaagccattaaaagatcgacgctttata
caaattgatcgtgataatttcgacgatgttcttaagcgtatgagccctcgcttaaacttc
aaagttgataataaattaatgaatgatggcactgagttgagtctttctttggcatttaat
tcaatgcaagattttgagcctgcggccatagttaatcaagttgaaccactgaaaaagttg
cttgaaacgcgtactaaactgcgcgatttaatgacaaaaattgatcgttcagaagatctt
gaaaatgtattagaaaaagtattgaacaatacggataacctgtctcaattggctaacgaa
ttaaatgtaggtaatgacaatccagagaagcagcctgaaggagaaggtgcctaa

DBGET integrated database retrieval system