KEGG   Photobacterium profundum: PBPRA0667Help
Entry
PBPRA0667         CDS       T00173                                 

Gene name
RSP0744
Definition
(GenBank) conserved hypothetical protein
  KO
K11900  type VI secretion system protein ImpC
Organism
ppr  Photobacterium profundum
Brite
KEGG Orthology (KO) [BR:ppr00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ppr02044]
    PBPRA0667 (RSP0744)
Secretion system [BR:ppr02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PBPRA0667 (RSP0744)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VipB
Motif
Other DBs
NCBI-ProteinID: CAG19088
UniProt: Q6LUD7
Position
1:733291..734781
Genome map
AA seq 496 aa AA seqDB search
MNAQTEALLDPATAETSRSFLEEAIVATKQTDSSRAEELLRTLTEEALKGTVTWNKNLTV
TFNDAIKGIDDAISSQLAEIMHQPEFQKLEGSWRGLHYLAMNSDTGQTLKIRMLSLSKKE
LHKDLSKAVEFDQSQIFKKVYEAEFGTPGGEPYGALIGDYEFTNHPEDIEMLGLMSNVAA
AGFSPFLSAASPELFGFDEWEELSKPRDLDKVFESLEYTQWRSFRESPDSRFVTLTMPRV
LSRLPYGQTTLPIEEFRYEELTIDDESGLAINAKHDDYCWMNASYVMGAKMTAAFSKYGF
CTAIRGAEGGGKVDNLPAHVFMSDDGDPDLKCPTEVGITDRRESELGRLGFLPLCHYKNT
NYAVFFGGQTCQKPTKFDTLEASANAEISARLPYMMATSRFAHYLKVMARDKIGSFMEAD
DVERWLNRWILSYVNATEDAGQEIRAKYPLADAKVKVQEIPGQPGAYHAVAWLRPWLQME
ELTTSLRLVAKIPEIS
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcacaaacagaggcattactcgatcctgcaacagcagaaaccagtcgatctttc
cttgaggaagctattgttgccactaagcaaacagacagctctcgtgccgaagaattgtta
cgtacgttaacggaagaagcgctaaagggaacggtgacttggaataaaaacctaacagtg
acctttaatgatgccattaagggaattgatgatgctatttcatcacaacttgccgagatc
atgcaccaacctgaatttcagaagcttgaaggcagttggcgtggtctgcactatcttgca
atgaactcggatactggacaaacattgaaaattcggatgctgagtctgagtaagaaagag
ctacataaagatttaagtaaggctgttgaatttgatcaaagccagattttcaaaaaggtt
tatgaggctgaatttggtacaccaggtggagaaccatacggtgcattaattggtgattat
gaatttactaatcatccggaagatattgaaatgctgggcttaatgtcaaatgttgcagcg
gctggtttctctcccttcttatctgcggcttcacctgaactatttggttttgatgagtgg
gaagagttaagcaaaccaagagatttagataaagtgtttgagtcgcttgaatatacacaa
tggcgatcattccgtgaaagccctgactcacgttttgtcaccttaacaatgccacgagta
ttgtcgcgtttaccttatggccaaacgacgttgccaattgaagaattccgctacgaagag
ttaacgattgatgatgaaagtggtttggccattaacgctaagcatgatgattattgttgg
atgaatgcctcgtatgtaatgggcgcgaagatgacggccgcgttctctaaatatggcttt
tgtaccgcgattcgcggggctgaaggaggaggaaaagttgataatcttccggctcatgtt
tttatgagtgatgatggtgacccagatttgaaatgtccgactgaagttggcattaccgat
cgccgtgagtcggaactgggtagattgggtttcttaccgttatgtcattataaaaatact
aactatgctgtgttctttggtggccaaacatgtcaaaagccaactaaatttgacacgcta
gaagcatcggcaaatgcggaaatttcggcgcgtttaccgtatatgatggcaacatcacgt
tttgcccattatttgaaagtaatggcacgtgacaaaattggtagcttcatggaagcggat
gatgttgagcgctggttaaaccgttggattttatcttatgtcaatgcaactgaagatgca
gggcaagaaattcgcgcgaaatatccactagctgatgcaaaagtaaaagtacaagaaatt
cctggccagccaggtgcttaccatgcggttgcttggttacgtccttggttacaaatggaa
gagttgaccacttcattgcgtcttgtcgcaaaaatacctgaaattagttaa

DBGET integrated database retrieval system