KEGG   Photobacterium profundum: PBPRA0669Help
Entry
PBPRA0669         CDS       T00173                                 

Gene name
VPA1032
Definition
(GenBank) hypothetical protein
  KO
K11898  type VI secretion system protein ImpE
Organism
ppr  Photobacterium profundum
Brite
KEGG Orthology (KO) [BR:ppr00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ppr02044]
    PBPRA0669 (VPA1032)
Secretion system [BR:ppr02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   PBPRA0669 (VPA1032)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ImpE
Motif
Other DBs
NCBI-ProteinID: CAG19090
UniProt: Q6LUD5
Position
1:736388..737182
Genome map
AA seq 264 aa AA seqDB search
MLNVNSRLQNESISDIISDYIQQLKNTPSNSDVRSDFIELLCIDGQLERADQQLSLLIQQ
CPEYLVGGNNLRQLIHAAQARVDFFNGNATAKLLVGDQDSFQHFVELIFARNQGLVEQVI
HHTTQLDAKRKPAPLTVNGVAYDDCRDLDDLLAGYLEVFGTDGQYYLLPFSSIHRLQFMP
ISSLVEMTWRKVDIDVIDGPSGDAFIPMTYLTSLTDAEKLGKETDWREISSTPVVIGLGQ
KMWLVGEEAMAVMQCELIEGTAVN
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgttaaatgttaatagccgtcttcagaatgaaagtatctctgatattatttcagattac
attcagcagttaaaaaacacaccaagtaatagtgatgtacgcagtgattttattgaatta
ctgtgtatcgatggccaactagaacgtgcagatcagcagttgtcgttattaatacaacaa
tgtcctgaatatttggttggtggtaataatttacgtcaacttattcatgcagctcaagca
agggtcgatttttttaatggcaatgccacggcaaaactattagtcggtgaccaagattca
ttccagcactttgttgaattaatattcgccagaaatcaagggttggtggaacaagttatt
catcatacaacgcaattagacgccaagcgtaaacctgcacctttaaccgttaatggggtt
gcttacgacgattgtcgtgatcttgatgatttattagcgggttatctcgaagtgtttggc
acggatggacaatactatcttttgccattttcttccatccatcgccttcaattcatgccg
atctcttcgttagtcgaaatgacttggcgtaaagttgatattgacgtaattgatgggcca
agtggagatgcgttcatcccaatgacttacctgacgagtttaactgatgcagagaaacta
gggaaagaaacggattggagagaaatatcatcgactcctgttgttattggcctagggcaa
aaaatgtggctggtcggtgaagaggcgatggctgtaatgcaatgtgaattaattgaaggc
acagctgtaaattga

DBGET integrated database retrieval system