KEGG   Photobacterium profundum: PBPRA0674Help
Entry
PBPRA0674         CDS       T00173                                 

Gene name
VPA1027
Definition
(GenBank) conserved hypothetical protein
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
ppr  Photobacterium profundum
Pathway
ppr03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ppr00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PBPRA0674 (VPA1027)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ppr02044]
    PBPRA0674 (VPA1027)
Secretion system [BR:ppr02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PBPRA0674 (VPA1027)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_HCP CBM-like
Motif
Other DBs
NCBI-ProteinID: CAG19095
UniProt: Q6LUD0
Position
1:743312..743791
Genome map
AA seq 159 aa AA seqDB search
MQANTYLKYGDIKGETTAKDYEGMITLLSVDWGVGREITSFTGTAQDREASSTRLHDMTI
TKLQDKASTYLFKEATIGKGTDIQFYVTRQGDKVEEILKLELTDAMIANFNVVVNDDRPT
ETITISYTEMVMTVTPTDDDNNLEPKVVWGYSGVTGQKK
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgcaagctaatacttacctgaaatatggtgatattaagggtgaaactacagctaaagat
tatgaagggatgattacactgctctctgttgattggggagtcggtcgtgaaattacttca
ttcacgggtacagcacaagatcgtgaagcgagttctacacgtcttcatgatatgaccatc
actaagcttcaagacaaagcctcaacgtatttatttaaagaagcaaccattggtaaagga
acagacattcagttctatgtgaccaggcaaggtgataaagttgaagaaattctgaagctt
gaactaacagatgcaatgattgccaattttaacgttgttgttaatgatgatcgtccaact
gaaacaattaccatttcttacactgaaatggtaatgacggtaacacctaccgatgatgat
aataaccttgagcctaaggttgtttggggttacagcggcgttactggtcagaaaaaataa

DBGET integrated database retrieval system