KEGG   Photobacterium profundum: PBPRA0723Help
Entry
PBPRA0723         CDS       T00173                                 

Gene name
YPO3203
Definition
(GenBank) putative phosphate-binding protein
  KO
K02040  phosphate transport system substrate-binding protein
Organism
ppr  Photobacterium profundum
Pathway
ppr02010  ABC transporters
ppr02020  Two-component system
Module
ppr_M00222  Phosphate transport system
Brite
KEGG Orthology (KO) [BR:ppr00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    PBPRA0723 (YPO3203)
  09132 Signal transduction
   02020 Two-component system
    PBPRA0723 (YPO3203)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ppr02000]
    PBPRA0723 (YPO3203)
Transporters [BR:ppr02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Phosphate transporter [MD:M00222]
    PBPRA0723 (YPO3203)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PBP_like_2 PBP_like SBP_bac_11 SBP_bac_1 LysR_substrate
Motif
Other DBs
NCBI-ProteinID: CAG19136
UniProt: Q6LU89
Position
1:800036..800998
Genome map
AA seq 320 aa AA seqDB search
MSVIRRILPMILAFSMHNAWALEADLAKYQKISGVSGNLSSVGSDTLANLMTYWGEEFKR
KYPNVNIQIQTAGSSTAPTALTEATAQLGPMSRKMKAKEIEAFEHEYGYKPTAIRVAIDA
LAVFVHEDNPLKGINFEQLDAVYSRTYRCGATQPITRWGQLGLTGRWADRDIQRFGRNSV
SGTYGYFKLRALCKGDFLNNVNEQPGSASVVQSVSTSLNAIGYSGIGYKTTGIRAIPVAR
EGDNYVDATIENSINGSYPLARYLYVYVNKHPNKPLDPILTEFFKFVLSHNGQSIVEKDG
YIPLPKSVVEADLALLKVLN
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtaatacgccgtattcttcccatgatactcgcattcagtatgcacaatgcttgg
gcattagaagccgatttagccaaataccaaaagatcagtggtgtctctggtaatttatcg
tctgtcggttcagacacgctcgcgaacctgatgacctattggggcgaggaatttaaacgt
aaatacccgaatgtgaatattcaaattcaaaccgcaggttcatctacagcccctaccgca
ttaacagaagcaacggctcaacttggccctatgagccgtaaaatgaaggccaaagaaatt
gaagcttttgaacatgaatacggttataagccaacagccattcgtgtcgccattgacgct
ttggcagtgtttgttcatgaagataacccgttaaagggcattaattttgagcagcttgat
gccgtatattctcgaacatatcgttgtggtgcaacgcagcctattacacgttgggggcaa
ttaggtttaacagggcgttgggctgaccgagatattcaacgctttggacgaaattcggta
tcaggtacgtatggttattttaagctacgagccctgtgcaaaggtgattttcttaataat
gttaatgagcagccaggctctgcatccgtcgtacagtcggtatcaacatcattgaacgcg
attggttattcgggtattggttataaaacaacgggtattcgtgcgattccagtggcgaga
gagggagataactatgtggatgcaactattgaaaattcgataaatggcagttacccacta
gctcgttacctctacgtatatgttaataagcatccgaataaaccattagacccaattttg
actgagttttttaaatttgttttatcgcacaatgggcaaagtattgttgaaaaagatgga
tatattccattaccaaaaagtgttgttgaagccgatttagccttgcttaaagtattgaat
taa

KEGG   Photobacterium profundum: PBPRA1394Help
Entry
PBPRA1394         CDS       T00173                                 

Gene name
PSTS
Definition
(GenBank) putative phosphate ABC transporter, periplasmicphosphate-binding protein
  KO
K02040  phosphate transport system substrate-binding protein
Organism
ppr  Photobacterium profundum
Pathway
ppr02010  ABC transporters
ppr02020  Two-component system
Module
ppr_M00222  Phosphate transport system
Brite
KEGG Orthology (KO) [BR:ppr00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    PBPRA1394 (PSTS)
  09132 Signal transduction
   02020 Two-component system
    PBPRA1394 (PSTS)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ppr02000]
    PBPRA1394 (PSTS)
Transporters [BR:ppr02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Phosphate transporter [MD:M00222]
    PBPRA1394 (PSTS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PBP_like_2 PBP_like SBP_bac_11 SBP_bac_1 Phage_TTP_1 AnfO_nitrog LysR_substrate
Motif
Other DBs
NCBI-ProteinID: CAG19805
UniProt: Q6LSC1
Position
1:complement(1567490..1568314)
Genome map
AA seq 274 aa AA seqDB search
MKTKVIGALALAGSMAFSVAAVANETISVVGSSSVTPLMEVFGETYSQAHSNVFVEVQGP
GSSAGVRAATDGSADLGMSSRNLKDSEKSDDLKEIVVARDGIAVVVNNKNPITDLSKEDV
TKIYKGEITNWNQVGGEDKPIVVVTRDTASGTRGAFEDIMSLKKKINDITVSAISQRAQV
TSGNGQLKTTVANNPFAIGYISLGTVDDSLKALSIDGHVPSVAAIKSGEYQVQRPFLVLY
KTSKINPTTQSFLDWTLTTEAQKIVSAKGYIAVN
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaaaggttatcggtgcactagctcttgcaggttcaatggcattcagtgttgct
gcagttgcaaacgaaactatctctgttgtaggttcaagttcagttacaccattaatggaa
gtgtttggtgaaacttacagccaagcacactctaatgtttttgttgaagttcaaggccca
ggttcatcagctggtgttcgtgccgcaaccgatggttctgctgatttaggtatgagttct
cgtaatcttaaagattcagagaaatcagatgatttaaaagaaattgtcgttgcacgtgat
ggtatcgctgttgtagttaacaacaagaacccaatcactgacttatcaaaagaagacgta
acgaagatttacaaaggtgaaatcactaactggaaccaagttggcggtgaagataagcca
atcgtagtggtaacacgtgacacagcatctggtacacgcggtgctttcgaagacatcatg
tcgctgaagaaaaaaattaacgacatcacagtatcagctatctctcagcgtgctcaggtt
acaagtggtaacggccaacttaaaacaacagttgctaacaacccgtttgcaattggttat
atctctcttggtactgttgatgattcactaaaagcactatcaatcgacggtcacgtacct
tcagttgcagctatcaaatctggtgaataccaagttcaacgtcctttccttgtgctttac
aagacaagcaaaattaacccaaccacgcagtctttcttagattggacgctaaccactgaa
gcacagaaaattgtttcagctaaaggctacattgcagttaactaa

KEGG   Photobacterium profundum: PBPRB0883Help
Entry
PBPRB0883         CDS       T00173                                 

Gene name
PSTS
Definition
(GenBank) hypothetical ABC transporter, periplasmic substrate-binding protein
  KO
K02040  phosphate transport system substrate-binding protein
Organism
ppr  Photobacterium profundum
Pathway
ppr02010  ABC transporters
ppr02020  Two-component system
Module
ppr_M00222  Phosphate transport system
Brite
KEGG Orthology (KO) [BR:ppr00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    PBPRB0883 (PSTS)
  09132 Signal transduction
   02020 Two-component system
    PBPRB0883 (PSTS)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ppr02000]
    PBPRB0883 (PSTS)
Transporters [BR:ppr02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Phosphate transporter [MD:M00222]
    PBPRB0883 (PSTS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PBP_like_2 PBP_like SBP_bac_11 SBP_bac_1 SBP_bac_8
Motif
Other DBs
NCBI-ProteinID: CAG22755
UniProt: Q6LIX5
Position
2:complement(1019226..1020083)
Genome map
AA seq 285 aa AA seqDB search
MKSNLLRRKSMFFRATTLVALCASVAFSAQAKTDTVTITGSTSVSHVMEILAEAYSTSHI
DTFIAVQGIGSSAGISAVKQDATEIGMSSRRLSEDEINPDVKMVTIAHDGIALVVNQNNP
VNNLTKEQVSKIYHGEIKNWQEVGGPNLKMAVVSRENASGSRFSFEDFMGLTQNIEGQRV
SDINPQLLVVNTNGMVKSLVSRNVHALGYMSLGSVDDSIKPLSFEGVKPTIDNLESGEYL
ISRPFLMLYKEKNVSKNAQAFLNYVISNEGQNIIGERGYITNHKS
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
gtgaaatctaacttattacggagaaagtcaatgttttttagggcaactacccttgtggca
ttgtgtgcaagcgtggcgtttagtgcacaagccaaaacagatactgtcacaattactgga
tcaacatcagtaagccatgtgatggaaatcttagcagaagcttattcaacctctcatata
gatacttttattgctgttcaaggcataggttcttctgctggcatttctgcagtaaaacaa
gatgccacagaaataggtatgagctctcgccgtctgagtgaagatgagataaaccctgat
gtgaaaatggtaacaattgcacatgatggcattgctttggtcgtcaatcaaaacaaccct
gttaacaacctcacaaaagagcaagtatcaaagatttaccatggggaaattaaaaactgg
caggaagtcggtggtccaaatctaaaaatggctgttgttagccgtgaaaatgcttctggc
tcacgcttttcttttgaagactttatgggcttaacccaaaacattgaaggtcaaagggta
tctgatataaacccacaactcttagtagttaacactaatggcatggtgaaaagtttagtc
tctcgtaatgtacatgcacttggctatatgtctttaggttctgtggatgactctattaag
ccgttgtcttttgaaggcgttaagccaaccattgataacctcgaatcaggagagtattta
atctctcgcccttttttaatgttatataaagagaagaacgtatcaaaaaatgcacaagcg
tttttaaactacgttatttctaatgaagggcagaatattatcggtgaacgtggatacatt
acgaaccataaaagttaa

DBGET integrated database retrieval system