KEGG   Photobacterium profundum: PBPRA2009Help
Entry
PBPRA2009         CDS       T00173                                 

Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
ppr  Photobacterium profundum
Pathway
ppr00790  Folate biosynthesis
ppr01100  Metabolic pathways
Module
ppr_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:ppr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PBPRA2009
Enzymes [BR:ppr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     PBPRA2009
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF
Motif
Other DBs
NCBI-ProteinID: CAG20412
UniProt: Q6LQL4
Position
1:complement(2314896..2315549)
Genome map
AA seq 217 aa AA seqDB search
MTALSESALMVRAALEERGLETPMTSKVVSREEKKEKIEYHMREILELLSLDLTDDSLME
TPHRIAKMYVDEVFSGLDYANFPKITVIENKMKCDEMVRVKGITLTSTCEHHLVTIDGKA
TVAYIPRGKIIGLSKINRIVRFFAQRPQVQERMTQQILVALQTLLESDDVAVTIDATHYC
VKARGVMDATSETTTTALGGIFKRIPATRAEFFHGIR
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgacagcattaagcgaatctgcattgatggtacgcgcagcacttgaagaacgtgggctt
gaaacacccatgacgagtaaagtggtaagccgcgaagagaaaaaagaaaagatcgaatat
cacatgcgtgagatcttagagttattgtcgttagatttaaccgacgatagcctaatggaa
actccgcatcgcatcgctaagatgtatgttgatgaagtcttttcaggtttagattatgcg
aatttcccaaaaattaccgtaatcgaaaacaaaatgaaatgtgatgaaatggtacgtgta
aaaggcattacgctgaccagtacttgtgaacatcaccttgttacgattgatggtaaagcg
acggttgcgtacattccgcgtggtaaaatcattggtctatcaaagattaaccgcatcgtt
cgtttctttgctcagcgccctcaggtgcaagagcgaatgacacagcaaatcttagttgcg
ctgcaaacattgcttgaaagtgatgatgtggccgtaacgattgatgcgacccactactgc
gtgaaagcacgtggtgtgatggatgcaaccagtgaaacgacgacgactgcacttggcggt
atctttaaaaggattcctgcaacgcgtgctgagtttttccacggcattcgctag

DBGET integrated database retrieval system