KEGG   Photobacterium profundum: PBPRA2490Help
Entry
PBPRA2490         CDS       T00173                                 

Definition
(GenBank) Putative tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ppr  Photobacterium profundum
Pathway
ppr00260  Glycine, serine and threonine metabolism
ppr00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ppr01100  Metabolic pathways
ppr01110  Biosynthesis of secondary metabolites
ppr01130  Biosynthesis of antibiotics
ppr01230  Biosynthesis of amino acids
Module
ppr_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ppr00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PBPRA2490
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PBPRA2490
Enzymes [BR:ppr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PBPRA2490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: CAG20872
UniProt: Q6LPA4
Position
1:2884093..2885283
Genome map
AA seq 396 aa AA seqDB search
MSKLDAYFGEFGGQYVPQILVPALDQLEDAFIEAQQDPAFQKEFIDLLKDYAGRPTALTL
CQNLTKGTKTKLYLKREDLLHGGAHKTNQVLGQALLAKRMGKKEIIAETGAGQHGVATAL
ACALLGLKCRVYMGAKDIERQSPNVFRMKLMGATVIPVHSGSSTLKDACNEAMRDWSATY
EEAHYLLGTAAGPHPFPTIVREFQRIIGEETKVQILEKEGRLPDAVIACVGGGSNAIGMF
ADFIDEKDVSLIGVEPAGKGLDTKMHGAPLKHGKLGIFFGMKAPLMQDEHGQVEESYSVS
AGLDFPSVGPQHAHLNAIGRAEYGSVTDDEALDAFQLLARKEGIIPALESAHALAYALKM
IEAEPEKEQLLVVNLSGRGDKDIFTVHDILDAKGVL
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaattagatgcctacttcggtgaatttggtggtcagtacgtaccacaaatttta
gtaccagcgttagatcaactggaagatgcttttattgaagcacaacaagatccagcgttt
caaaaagagtttatcgatctattaaaagattacgctggtcgcccaacagccttaacgtta
tgtcagaacctgactaaaggcacaaaaactaagttatacctaaagcgtgaagatttactt
cacggtggcgctcataaaaccaatcaggtattaggtcaggcgctacttgctaagcgcatg
ggtaaaaaagaaatcattgctgaaacgggcgcaggtcaacacggtgttgccacagcatta
gcatgtgcactattaggccttaaatgtcgcgtttacatgggcgcaaaagatattgaacgt
caaagcccgaatgtattccgcatgaagttgatgggtgccacggttattcctgtgcattca
ggatcttctactctgaaagatgcttgtaacgaagcgatgcgcgactggtctgcaacatat
gaagaagcgcactacctactgggtactgctgccggtccacacccattcccaaccattgtg
cgtgaatttcaacgtatcattggcgaagaaaccaaagtacagattttagaaaaagaaggt
cgcctacccgatgctgttattgcatgtgtaggtggtggttcaaacgctattggtatgttt
gcagatttcatcgatgaaaaagacgttagcttaattggtgttgaacctgccggtaaaggt
ttagataccaagatgcacggtgcgccgcttaaacacggtaaactgggtattttctttggc
atgaaagcgccactgatgcaagatgaacatggccaggttgaagaatcttactcagtatca
gccgggttagatttcccatcggttggtcctcaacacgcgcaccttaacgcaataggccgt
gctgaatacggctcagtaacagatgatgaagcactcgatgcattccagttactggcgcgt
aaagaaggcattattccggcgttagaatctgcacacgcattagcttatgcattaaaaatg
attgaagctgaaccagaaaaagagcaacttttggttgttaacctttccggtcgtggcgac
aaagacattttcaccgtacacgatattttggacgcaaagggagtattgtaa

DBGET integrated database retrieval system