KEGG   Photobacterium profundum: PBPRA2592Help
Entry
PBPRA2592         CDS       T00173                                 

Gene name
PLU2551
Definition
(GenBank) Putative selenophosphate synthase
  KO
K01008  selenide, water dikinase [EC:2.7.9.3]
Organism
ppr  Photobacterium profundum
Pathway
ppr00450  Selenocompound metabolism
ppr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    PBPRA2592 (PLU2551)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ppr03016]
    PBPRA2592 (PLU2551)
Enzymes [BR:ppr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.9  Phosphotransferases with paired acceptors
    2.7.9.3  selenide, water dikinase
     PBPRA2592 (PLU2551)
Transfer RNA biogenesis [BR:ppr03016]
 Eukaryotic type
  tRNA modification factors
   Other tRNA modification factors
    PBPRA2592 (PLU2551)
 Prokaryotic type
    PBPRA2592 (PLU2551)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AIRS_C AIRS
Motif
Other DBs
NCBI-ProteinID: CAG20971
UniProt: Q6LP05
Position
1:complement(3001794..3002834)
Genome map
AA seq 346 aa AA seqDB search
MENVRLTQYSHGAGCGCKISPQVLDTILRTQLAPFSDPNLLVGNESKDDAAVYDLGNGTA
AISTTDFFMPIVDDPFDFGRIAATNAISDIYAMGGKPIMAIAILGWPVNVLAPEIAQQVI
EGGRSVCREAGISLAGGHSIDAPEPIFGLAVTGIVDTDRVKRNNRAENGCKLYLTKPLGI
GVLTTAEKQSKLADEHKGLARDWMCKLNIPGQDFANVEGVKAMTDVTGFGLMGHLSEICE
GSQLKARVDFDSVPYLPGVFDYIAQGCVPGGTTRNFDSYGQKLGAMTEQQKALLCDPQTS
GGLLIAVTPDAETEQQLQAIAARHNIELQAIGEMMPLDGDTLIEIC
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatgttcgccttactcaatacagccacggtgcaggatgtggttgtaaaatttct
cctcaagttcttgatactattctccgaactcagttagcaccattttcagatcctaatctt
cttgtcggtaatgaaagtaaagatgatgcagctgtttatgatttaggtaatggcactgct
gcaatcagtaccacagatttctttatgccgattgtcgatgacccatttgacttcggtcgt
attgcggcaacgaatgcaatcagtgatatttatgcgatgggcggtaagccgatcatggcg
attgcaattctaggttggcccgtcaatgtattggcacctgaaatcgctcaacaagtgatt
gaaggtggtcgttcagtgtgccgtgaagcgggtatttctcttgctggtggtcactcgatt
gatgcgcctgaacctatttttggtcttgccgtaacaggtattgtcgataccgatcgggta
aaacgtaataaccgtgcggaaaacggctgtaagttgtatttaactaagccgttgggtatt
ggtgtattaacaacagcagagaagcaatctaagttagcggatgagcacaaaggcttagca
cgtgactggatgtgtaaactgaatattccgggtcaagactttgctaatgtcgagggcgtt
aaagccatgacagacgtgacagggtttggcttgatggggcacctaagcgagatttgtgaa
ggtagccaactaaaagcacgtgttgattttgatagtgtaccgtacctacctggtgtattt
gattacatagcacaaggttgtgtaccgggtggcaccacgcgtaactttgatagttacggt
caaaaattaggtgcaatgacagaacaacaaaaagcgttgttatgcgatccacaaacatcg
ggtggcctacttattgccgtaacccctgatgcggaaacggagcagcagctgcaagcaatt
gctgcacgtcataatattgaattgcaagctattggtgaaatgatgccgttagacggcgat
acattgattgagatttgctaa

DBGET integrated database retrieval system