KEGG   Photobacterium profundum: PBPRA2841Help
Entry
PBPRA2841         CDS       T00173                                 

Definition
(GenBank) putative 2-dehydro-3-deoxyphosphooctonate aldolase
  KO
K01627  2-dehydro-3-deoxyphosphooctonate aldolase (KDO 8-P synthase) [EC:2.5.1.55]
Organism
ppr  Photobacterium profundum
Pathway
ppr00540  Lipopolysaccharide biosynthesis
ppr01100  Metabolic pathways
Module
ppr_M00063  CMP-KDO biosynthesis
Brite
KEGG Orthology (KO) [BR:ppr00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    PBPRA2841
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:ppr01005]
    PBPRA2841
Enzymes [BR:ppr01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.55  3-deoxy-8-phosphooctulonate synthase
     PBPRA2841
Lipopolysaccharide biosynthesis proteins [BR:ppr01005]
 Unusual sugar
  PBPRA2841
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAHP_synth_1
Motif
Other DBs
NCBI-ProteinID: CAG21208
UniProt: Q6LNB8
Position
1:complement(3291450..3292304)
Genome map
AA seq 284 aa AA seqDB search
MMEQKTVRVGDIDVANDKPFVLFGGMNVLESRDLAMKICEHYVEVTNKLGIPFVFKASFD
KANRSSVHSYRGPGMEEGLKIFQELKDTFGVKIITDIHEIYQAQPVADVVDVIQLPAFLA
RQTDLVEAMAKTGAVINVKKPQYMSPGQVGNIVEKFAECDNENVILCERGALHGYDNLVV
DMLGFDVMKKASKGSPIIFDVTHALQCRDPLGAASGGRREQTVDLARSGIATGIAGLFME
AHPAPDQARCDGPSAFPLDKLEPFLNQIKQLDDLIKGFEAIEIN
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgatggaacaaaaaactgttcgcgttggtgatattgatgtggctaacgacaagcctttt
gtcttgttcggtggtatgaacgtactagagtctcgcgatcttgctatgaagatctgtgag
cattatgttgaagtaaccaacaagctaggcattccattcgtattcaaagcctcttttgat
aaagcaaaccgctcatcagtccattcataccgtggtcctggtatggaagaaggtttgaag
atttttcaagagttgaaagatacgtttggcgttaaaatcatcactgatattcatgagatt
tatcaagctcagcctgttgctgatgttgttgatgttattcagcttcctgcttttcttgcc
cgccagactgatctagttgaagcgatggcaaaaacaggtgccgtgattaatgtgaaaaaa
ccacaatacatgagccctggtcaagtcggtaacattgttgagaagttcgctgagtgtgat
aacgagaatgtgattctttgtgagcgtggtgcgctgcatggctacgataaccttgttgtt
gatatgcttggtttcgatgtaatgaaaaaagcatcaaaaggtagcccaatcatctttgac
gtaacgcatgcactgcaatgccgtgatccattaggtgcagcatctggtggtcgtcgtgag
caaaccgttgatttggctcgttcaggtattgcgacgggtattgcgggtctatttatggaa
gcgcatccagcaccagaccaagctcgttgtgatggtccttctgctttcccattggataag
ctagaaccattcctaaaccagatcaagcagcttgatgatttgatcaagggttttgaggct
attgaaattaattaa

DBGET integrated database retrieval system