KEGG   Photobacterium profundum: PBPRA2987Help
Entry
PBPRA2987         CDS       T00173                                 

Gene name
STY3120
Definition
(GenBank) putative SAM-dependentmethyltransferase
  KO
K06968  23S rRNA (cytidine2498-2'-O)-methyltransferase [EC:2.1.1.186]
Organism
ppr  Photobacterium profundum
Brite
KEGG Orthology (KO) [BR:ppr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:ppr03009]
    PBPRA2987 (STY3120)
Enzymes [BR:ppr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.186  23S rRNA (cytidine2498-2'-O)-methyltransferase
     PBPRA2987 (STY3120)
Ribosome biogenesis [BR:ppr03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    PBPRA2987 (STY3120)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RlmM_FDX FtsJ THDPS_N_2
Motif
Other DBs
NCBI-ProteinID: CAG21321
UniProt: Q6LN05
Position
1:complement(3423796..3424878)
Genome map
AA seq 360 aa AA seqDB search
MNHVILYCRPGFEKECAGEVQDKANKLELFGFPRTKNNTGYVVFEFHQQGDADKFIKLQP
FSSLIFARQMFAATKLLTDLPQEDRISPILEAVKGFPRCGELRIETPDTNEAKELLKFCR
KFTVPLRQAMRKKDVLYAQDSTWKPVLHVCFIAPGCCFVGYSYTNNNSQFFMGIPRLKFP
SDAPSRSTLKLEEAFHVFIPRDEWDERLAPGMWGVDLGACPGGWTYQLVKRSMFVHAIDN
GQMAQSLMDTGQVKYHAVDGFKFEPARKNVTWIVCDMIEKPARVAHLMGEWLVKAWAKEA
IFNLKLPMKGRYDEVLQDIENLKQYFIKNGMKFELQAKHLYHDREEITVHVRCLDNRSPH
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
gtgaatcacgttatattgtattgtcgtccaggctttgaaaaagaatgtgctggtgaagtt
caagataaagcgaacaaactggagttatttggttttcctcggacgaaaaacaataccggt
tatgtggtatttgaatttcatcagcagggtgatgccgataaattcattaaattacagcct
ttttcttcattaatttttgcacgtcaaatgttcgcagcaacgaaactgctaacagactta
ccgcaagaagatcgtatttcaccgatccttgaagctgtaaaaggttttccacgttgtggt
gaactacgtattgaaacgccagacacaaatgaagcgaaagagttattaaaattctgtcgt
aagtttaccgtgcctcttcgccaagcaatgcgtaagaaagatgtgttgtacgcacaagat
agtacgtggaaaccagtgcttcacgtctgctttatcgcaccgggttgttgtttcgtgggt
tattcttacacaaataataattcgcagttcttcatgggtatccctcgtttgaaattccca
tcagatgcgccaagccgttcaaccctaaaactggaagaagctttccatgtatttattcct
cgcgatgagtgggatgaacgtttagcaccaggtatgtggggcgttgatctgggtgcttgc
cctggcggttggacgtatcagttagtaaaacgttctatgtttgtgcatgcgattgataat
ggtcaaatggcgcaaagcctaatggatacaggccaagttaaatatcatgctgtagatggt
tttaagtttgaacctgcgcgtaaaaacgtaacatggatcgtatgtgacatgatcgaaaag
cctgcacgtgttgctcacttaatgggtgagtggctggttaaagcatgggcaaaagaagct
atcttcaaccttaaactgccaatgaaaggtcgttatgatgaagtacttcaagatattgaa
aacctaaagcaatacttcattaaaaatggaatgaagttcgagctacaggctaaacatctt
taccatgaccgtgaagaaataacggtacatgtacgttgcttagataatcgttctccgcac
taa

DBGET integrated database retrieval system