KEGG   Photobacterium profundum: PBPRA3195Help
Entry
PBPRA3195         CDS       T00173                                 

Gene name
S0114
Definition
(GenBank) putative pyruvate dehydrogenase E2 component dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ppr  Photobacterium profundum
Pathway
ppr00010  Glycolysis / Gluconeogenesis
ppr00020  Citrate cycle (TCA cycle)
ppr00620  Pyruvate metabolism
ppr01100  Metabolic pathways
ppr01110  Biosynthesis of secondary metabolites
ppr01120  Microbial metabolism in diverse environments
ppr01130  Biosynthesis of antibiotics
ppr01200  Carbon metabolism
Module
ppr_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ppr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PBPRA3195 (S0114)
   00020 Citrate cycle (TCA cycle)
    PBPRA3195 (S0114)
   00620 Pyruvate metabolism
    PBPRA3195 (S0114)
Enzymes [BR:ppr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     PBPRA3195 (S0114)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N GCV_H HlyD_D23 HlyD_3
Motif
Other DBs
NCBI-ProteinID: CAG21501
UniProt: Q6LMH6
Position
1:complement(3628517..3630505)
Genome map
AA seq 662 aa AA seqDB search
MISTNLLLHKQSLNSTSMQTRRTRYTRKRQLNMAIEINVPDIGADEVEVTEILVSVGDKV
EEEQSLITVEGDKASMEVPASQAGIVKEIKIAEGDTVSTGSLIMLFVEEKSEAEGAAAAP
AVEAAAPVAAAPAAAELKEVHVPDIGGDEVEVTEIMVAIGDSIEEEQSLLTVEGDKASME
VPAPFAGVLKEIKIAAGDKVSTGSLVMIFEVAGSGASVAPAAPVAQAAAPVAAAPVASAA
KEVNVPDIGGDEVEVTEIMVAVGDTVEEEQSLITVEGDKASMEVPAPFAGTVKEIKIVAG
DKVSTGSLIMVFEVAGSAPAPVAQAAAPVAASAPAAKPAQAAAPAGDFQENNEYAHASPV
VRRLAREFGVNLSKVKGTGRKSRIQKEDVQNYVKDALKRLESGAAASAKGGDGSALGLLP
WPKIDFSKFGEIETKPLSRIKKISGANLHRNWVMIPHVTQWDNADITALEAFRKEQNAIE
AKKDTGMKITPLVFIMKAVAKALEAFPSFNSSLSDDGASLILKKYVNVGIAVDTPNGLVV
PVFKDVNKKGIYELSEELMAISKKARSGKLTASDMQGGCFTISSLGGLGGTAFTPIVNAP
EVGILGVSKSEMKPVWNGKDFEPRLMLPLSLSYDHRVVDGAEGARFITYLNGCLSDIRRL
VL
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
gtgatatcgacaaatctgttgttgcacaagcaatcgctaaattcgacatcgatgcagaca
agacgaacccgctatacgcgtaagaggcaattaaacatggcaatcgaaattaatgtacct
gacattggtgcagacgaggttgaagtaactgagattcttgttagcgttggcgacaaggtt
gaagaagagcaatctctgatcactgtagaaggtgacaaagcctctatggaagtaccagct
tctcaagcgggtatcgttaaagaaattaaaatcgctgaaggcgatacggtttctactggt
tctttaattatgctgttcgttgaagaaaaaagtgaagcagaaggcgcagcagctgcgcca
gcagttgaagcggcggcacctgttgctgcagcgcctgcggcggctgagctaaaagaagta
catgttccagatatcggcggcgacgaagtagaagtgactgaaatcatggttgctatcggc
gacagcatcgaagaagagcaatctcttcttactgttgaaggcgacaaagcatcaatggaa
gtacctgcaccgtttgctggtgtactaaaagaaatcaaaattgcagctggcgataaagta
tcaactggttcgctagtaatgatctttgaagtagcaggttctggcgcatcagttgcacct
gcagcacctgttgctcaagcggcggcgcctgttgctgcggcaccagtagcatctgctgct
aaagaagtaaacgttcctgatatcggcggtgatgaagtagaagttactgaaatcatggtt
gctgttggcgatacagtagaagaagagcaatctcttattactgttgaaggtgacaaggct
tcaatggaagtgcctgcaccgtttgctggtactgttaaagaaatcaaaatcgttgctggt
gataaagtgtctacaggctctttgatcatggtctttgaagtagctggctccgcacctgca
cctgttgctcaagcggcagctccagtagcagcatctgctcctgcagcgaagcctgcacaa
gcagcagctccagctggcgatttccaagaaaacaacgaatatgcgcatgcatctccagtt
gttcgtcgtcttgctcgtgaatttggcgttaacctttctaaagttaaaggtactggtcgt
aagagccgtatccagaaagaagacgtacagaactacgtgaaagatgcgcttaagcgtctt
gaatctggtgcagctgcatctgctaaaggtggcgacggttctgcactgggtcttctacct
tggccgaaaattgatttcagcaagtttggtgagattgaaactaagcctctatctcgcatc
aagaagatttctggcgctaacctgcaccgtaactgggtaatgatcccgcatgttacacag
tgggacaacgcagacatcacggctctggaagcattccgtaaagagcagaacgcgattgaa
gcgaagaaagatactggcatgaagatcacaccacttgtgttcatcatgaaagctgttgcg
aaagcgcttgaagcattcccatctttcaactcttctctttcagatgacggtgcaagcctt
attctgaagaagtacgtgaacgtgggtatcgcggttgatacacctaacggcctagttgtt
cctgtctttaaagatgtgaacaagaaaggtatctacgagctatctgaagagctaatggct
atttctaagaaagcacgttctggcaagctaactgcatctgatatgcaaggcggctgtttc
actatctctagccttggtggcttaggtggtactgcattcacaccaatcgtgaacgcacca
gaagtgggtatcttaggtgtatctaagtctgaaatgaaacctgtatggaatggcaaggat
tttgaacctcgcctaatgcttcctctatcactatcttacgatcaccgtgtggtcgatggt
gctgaaggtgcacgtttcattacttacctaaacggttgcctatctgatattcgtcgctta
gtactgtaa

DBGET integrated database retrieval system