KEGG   Photobacterium profundum: PBPRA3312Help
Entry
PBPRA3312         CDS       T00173                                 

Gene name
STY4319
Definition
(GenBank) putative siroheme synthase
  KO
K02302  uroporphyrin-III C-methyltransferase / precorrin-2 dehydrogenase / sirohydrochlorin ferrochelatase [EC:2.1.1.107 1.3.1.76 4.99.1.4]
Organism
ppr  Photobacterium profundum
Pathway
ppr00860  Porphyrin and chlorophyll metabolism
ppr01100  Metabolic pathways
ppr01110  Biosynthesis of secondary metabolites
ppr01120  Microbial metabolism in diverse environments
Module
ppr_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:ppr00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PBPRA3312 (STY4319)
Enzymes [BR:ppr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.76  precorrin-2 dehydrogenase
     PBPRA3312 (STY4319)
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     PBPRA3312 (STY4319)
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.4  sirohydrochlorin ferrochelatase
     PBPRA3312 (STY4319)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TP_methylase NAD_binding_7 CysG_dimeriser Sirohm_synth_M F420_oxidored Pyr_redox Pyr_redox_2 UDPG_MGDP_dh_C
Motif
Other DBs
NCBI-ProteinID: CAG21610
UniProt: Q6LM67
Position
1:complement(3760306..3761715)
Genome map
AA seq 469 aa AA seqDB search
MDYLPIFTDLKRRPCLVVGGGDVAWRKARMLLKAGADVRVIAPVLNQAFQQAIEQQQVSH
VADEFESSHLDGIFLAIAATDRKAVNALVYQSANQRQVLVNVVDDTQRCSFIIPSIIDRS
PIIVAVSSSGKAPVLARLIREKLEALLPQHLGRMATIAGNFRARLAKTVTSFSARRQFWE
QVFDGRFSDLVACGQEQDAKQELINLTQSTSPQGQVALIGSGPGDAGLLTLRALQLMQQA
DVVLYDYLVSDEVMDLVRRDAELVCVGKKAGFHSVPQEETNQLIVKYAQQGKRVVRLKGG
DPFVFGRGGEELEVLFDANILFQVVPGITAAAGATAYAGIPLTHRDYAQTAMFVTGHLKA
ESDQMDWSTLARGKQTLVIYMGLMKSGHIQQQLLINGRAGDTPIAIIERGTQKKQKVIKG
QLSELEQLAKNAESPSLIVIGEVVNLSEKLHWFGKQEQSLQQSAVVKLA
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atggattacttgccaatttttacggatctgaagcgtagaccttgcctagtggtgggtggt
ggtgatgtggcatggcgtaaagctcgcatgctattaaaggccggagcggatgttcgtgtt
attgcaccagtgttgaatcaagcgtttcaacaagccattgagcaacagcaagtcagccat
gtagctgatgaatttgaatcttcacaccttgatggtatttttcttgcgatagcggcaact
gatcgtaaagccgttaatgcactggtgtatcaatcggctaatcagcgccaagtattagtc
aacgtggtggatgatacacagcgttgtagtttcattattccttctattatcgatcgctct
cctattattgtagcggtctcctcatcaggcaaagcccctgttcttgcgcgtttaatccgt
gagaagctagaagcgttattaccgcagcatttaggccgcatggcgactatcgcgggcaat
tttcgtgctcgcttagcgaaaacagtcacctcattttctgctcgtcgtcaattttgggag
caagtttttgatggcaggttttctgatcttgtggcttgcggccaagagcaagatgccaag
caagaattaattaacctgacacaatctacgtcacctcaaggtcaagttgcgcttattggt
tcaggtccaggcgacgcagggttattgaccttgcgtgcattgcagttaatgcaacaagcc
gatgtagttttatatgactacctcgtttctgatgaggtgatggatttagttcgccgagat
gccgaattagtctgtgtcggaaaaaaagcaggcttccacagtgtgccacaagaagagacg
aaccaacttatcgttaaatatgcgcagcaaggaaaacgtgttgtgcgtttgaaagggggc
gatccttttgtctttggccgggggggggaagagcttgaagtgttatttgacgccaatatc
ctttttcaagttgtgcctggtataactgcggctgctggggcgacagcttatgcgggtatt
ccattaactcaccgtgattatgcccaaaccgcaatgtttgttactggtcacttaaaagct
gaaagtgatcagatggattggtcgacactggcgcgcggtaaacaaactctcgtgatttat
atgggcttgatgaaatcgggtcatattcagcaacaactgcttattaatggtcgtgctggt
gatacgccgatcgcgattattgaaagaggcacgcaaaaaaaacagaaagttattaaaggc
cagttaagcgaacttgagcaactggcgaaaaacgctgagtcaccatcactaattgttatc
ggtgaggtggttaatttatcagaaaagttacattggttcggaaaacaggagcagtcatta
caacagtctgctgttgtaaagctggcataa

DBGET integrated database retrieval system